ANENILKLKLYRSLGVILDLENDQVLINRDGNIDILPLDNNLSDFYKTKYIWERLGK
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5t6j:A | 59 | 59 | 1.0000 | 0.9661 | 0.9661 | 6.74e-33 | 4geq:D, 4geq:B |
2 | 7kdf:C | 95 | 56 | 0.8772 | 0.5263 | 0.8929 | 4.44e-28 | |
3 | 5f9e:A | 336 | 36 | 0.2632 | 0.0446 | 0.4167 | 0.33 | 5f9e:B, 2jed:A, 2jed:B, 4q9z:A, 4q9z:B, 4ra5:A, 4ra5:B, 1xjd:A |
4 | 1i24:A | 392 | 29 | 0.1754 | 0.0255 | 0.3448 | 1.9 | 1i2b:A, 1i2c:A, 1qrr:A |
5 | 8ro2:C | 908 | 44 | 0.2456 | 0.0154 | 0.3182 | 5.0 | 7aav:r, 7abf:r, 7abg:r, 7abi:r, 6ah0:C, 6ahd:C, 8c6j:C, 8ch6:b, 7dvq:C, 6ff4:B, 6ff7:B, 9fmd:C, 8h6e:5C, 8h6j:5C, 8h6k:5C, 8h6l:5C, 8i0p:C, 8i0r:C, 8i0s:C, 8i0t:C, 8i0u:C, 8i0v:C, 8i0w:C, 6icz:C, 6id0:C, 6id1:C, 8q7q:C, 8q7v:C, 8q7w:C, 8q7x:C, 8q91:C, 6qdv:C, 8qp8:C, 7qtt:b, 6qw6:5C, 6qx9:5C, 8rc0:C, 7w59:C, 7w5a:C, 7w5b:C, 5xjc:C, 8y6o:D, 5yzg:C, 5z56:C, 5z57:C, 5z58:C, 6zym:B |
6 | 6cbq:A | 234 | 27 | 0.1754 | 0.0427 | 0.3704 | 7.8 | 6cbq:B, 6cc0:A, 6cc0:B, 3szt:A, 3szt:B |