ANAIAVGSERSADGKGMLLANPHFPWNGAMRFYQMHLTIPGRLDVMGASLPGLPVVNIGFSRHLAWTHTVDTSSHFTLYR
The query sequence (length=709) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
5ubk:A |
709 |
709 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
4k2f:B, 4k2g:B, 3l91:B, 4m1j:C, 3srb:A, 3srb:B, 3src:B, 4wks:C, 4wkt:C, 4wku:B, 4wkv:C, 2wyc:A, 2wyc:B |
2 |
4yf9:C |
575 |
578 |
0.2793 |
0.3443 |
0.3426 |
1.45e-89 |
4yf9:F, 4yf9:I, 4yf9:L, 4yfa:C, 4yfa:F, 4yfa:I, 4yfa:L, 4yfb:C, 4yfb:F, 4yfb:I, 4yfb:L |
3 |
1gk0:B |
522 |
551 |
0.1989 |
0.2701 |
0.2559 |
8.31e-35 |
2adv:C, 1gk0:D, 1gk1:B, 1gk1:D, 1jvz:B, 1jw0:B |
4 |
4yf9:D |
168 |
165 |
0.0832 |
0.3512 |
0.3576 |
7.38e-27 |
4yf9:A, 4yf9:G, 4yf9:J, 4yfa:A, 4yfa:D, 4yfa:G, 4yfa:J, 4yfb:D, 4yfb:A |
5 |
6nvy:B |
536 |
375 |
0.1255 |
0.1660 |
0.2373 |
3.84e-17 |
6nvy:D |
6 |
8brr:B |
527 |
571 |
0.1622 |
0.2182 |
0.2014 |
1.45e-16 |
8brq:B, 8brr:D, 8brs:B, 8brt:B, 6nvx:B |
7 |
6nvw:B |
527 |
132 |
0.0522 |
0.0702 |
0.2803 |
7.40e-13 |
|
8 |
3k3w:B |
551 |
208 |
0.0649 |
0.0835 |
0.2212 |
5.67e-09 |
3ml0:B |
9 |
7ea4:A |
762 |
111 |
0.0508 |
0.0472 |
0.3243 |
1.02e-07 |
7ea4:B, 7eby:A, 7eby:B, 7eby:C, 7eby:D, 7eby:E, 7eby:F |
10 |
1jvz:A |
152 |
140 |
0.0536 |
0.2500 |
0.2714 |
1.61e-07 |
|
11 |
1cp9:B |
553 |
210 |
0.0663 |
0.0850 |
0.2238 |
1.12e-06 |
|
12 |
1gm9:A |
207 |
110 |
0.0465 |
0.1594 |
0.3000 |
1.67e-04 |
1fxh:A, 1fxv:A, 1k7d:A, 1kec:A |
13 |
7rep:A |
764 |
177 |
0.0564 |
0.0524 |
0.2260 |
1.70e-04 |
4pel:B, 4pel:D, 4pel:F, 4pel:H, 4pem:B, 7reo:A |
14 |
7rep:A |
764 |
221 |
0.0691 |
0.0641 |
0.2217 |
0.001 |
4pel:B, 4pel:D, 4pel:F, 4pel:H, 4pem:B, 7reo:A |
15 |
1e3a:B |
560 |
221 |
0.0635 |
0.0804 |
0.2036 |
7.57e-04 |
1ai4:B, 1ai5:B, 1ai6:B, 1ai7:B, 1ajn:B, 1ajp:B, 1ajq:B, 1fxh:B, 1fxv:B, 1gk9:B, 1gkf:B, 1gm7:B, 1gm8:B, 1gm9:B, 1h2g:B, 1jx9:B, 1k5q:B, 1k5s:B, 1k7d:B, 1kec:B, 1pnk:B, 1pnl:B, 1pnm:B |
16 |
4hsr:B |
535 |
56 |
0.0282 |
0.0374 |
0.3571 |
0.60 |
4hst:B |
17 |
1nr9:A |
211 |
45 |
0.0240 |
0.0806 |
0.3778 |
0.91 |
1nr9:B, 1nr9:C, 1nr9:D |
18 |
6u0r:A |
527 |
45 |
0.0240 |
0.0323 |
0.3778 |
4.2 |
8fyw:A, 8fyw:B, 8fyw:C, 8fyw:D, 8fyw:E, 8fyw:F, 8fyw:G, 8fyw:H, 8fyw:I, 8fyw:J, 8fyw:K, 8fyw:L, 8fyw:M, 8fyw:N, 8fyw:O, 8fyw:P, 8fyw:Q, 8fyw:R, 8fyw:S, 8fyw:T, 8fyw:U, 8fyw:V, 8fyw:W, 8fyw:X, 8fyw:Y, 8fyw:Z, 8fyw:a, 8fyw:b, 8fyw:c, 8fyw:d, 8fyw:e, 8fyw:f, 8fyw:g, 8fyw:h, 8fyw:i, 8fyw:j, 8fyw:k, 8fyw:l, 8fyw:m, 8fyw:n, 8fyw:o, 8fyw:p, 8fyw:q, 8fyw:r, 8fyw:s, 8fyw:t, 8fyw:u, 8fyw:v, 8fyw:w, 8fyw:x, 8fyw:y, 8fyw:z, 8fyw:1, 8fyw:2, 8fyw:3, 8fyw:4, 8fyw:5, 8fyw:6, 8fyw:7, 8fyw:8, 3j4p:A, 7kfr:A, 7l6h:A, 7l6h:B, 7l6h:C, 7l6h:D, 7l6h:E, 7l6h:F, 7l6h:G, 7l6h:H, 7l6h:I, 7l6h:J, 7l6h:K, 7l6h:L, 7l6h:M, 7l6h:N, 7l6h:O, 7l6h:P, 7l6h:Q, 7l6h:R, 7l6h:S, 7l6h:T, 7l6h:U, 7l6h:V, 7l6h:W, 7l6h:X, 7l6h:Y, 7l6h:Z, 7l6h:a, 7l6h:b, 7l6h:c, 7l6h:d, 7l6h:e, 7l6h:f, 7l6h:g, 7l6h:h, 7l6h:i, 7l6h:j, 7l6h:k, 7l6h:l, 7l6h:m, 7l6h:n, 7l6h:o, 7l6h:p, 7l6h:q, 7l6h:r, 7l6h:s, 7l6h:t, 7l6h:u, 7l6h:v, 7l6h:w, 7l6h:x, 7l6h:y, 7l6h:z, 7l6h:1, 7l6h:2, 7l6h:3, 7l6h:4, 7l6h:5, 7l6h:6, 7l6h:7, 7l6h:8, 6u0r:B, 6u0r:C, 6u0r:D, 6u0r:E, 6u0r:F, 6u0r:G, 6u0r:H, 6u0r:I, 6u0r:J, 6u0r:K, 6u0r:L, 6u0r:M, 6u0r:N, 6u0r:O, 6u0r:P, 6u0r:Q, 6u0r:R, 6u0r:S, 6u0r:T, 6u0r:U, 6u0r:V, 6u0r:W, 6u0r:X, 6u0r:Y, 6u0r:Z, 6u0r:a, 6u0r:b, 6u0r:c, 6u0r:d, 6u0r:e, 6u0r:f, 6u0r:g, 6u0r:h, 6u0r:i, 6u0r:j, 6u0r:k, 6u0r:l, 6u0r:m, 6u0r:n, 6u0r:o, 6u0r:p, 6u0r:q, 6u0r:r, 6u0r:s, 6u0r:t, 6u0r:u, 6u0r:v, 6u0r:w, 6u0r:x, 6u0r:y, 6u0r:z, 6u0r:1, 6u0r:2, 6u0r:3, 6u0r:4, 6u0r:5, 6u0r:6, 6u0r:7, 6u0r:8, 5uf6:A |
19 |
6nvy:A |
191 |
48 |
0.0240 |
0.0890 |
0.3542 |
4.2 |
6nvy:C |
20 |
6nje:A |
297 |
87 |
0.0409 |
0.0976 |
0.3333 |
4.7 |
|
21 |
5i1v:A |
498 |
32 |
0.0197 |
0.0281 |
0.4375 |
6.8 |
5i1v:B, 5i1v:C, 5i1v:D, 5i1w:A, 5i1w:B, 5i1w:C, 5i1w:D |
22 |
1yrr:B |
334 |
78 |
0.0367 |
0.0778 |
0.3333 |
8.3 |
|