BioLiP

>protein
AMYILDKIGLNIEILESLSYESKLGMSFKRTLSHFNKEEVLKEIELINNWYFSLEIIDDLPLDSRIKSVSSAKMKFERYY
PNATYNRVFNDILGFRVICKSYDEVLELEKEDKIRVVDMSRGKSNDDGFRGIHVYYQRDNHHYPIEIQFNTYYDRQLNDW
LHDKFDSSCGQLLRKYYENGKIKSAEELEEV

The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8pu1:B	191	191	1.0000	1.0000	1.0000	1.13e-140	8pu4:A, 8pu4:B, 8pu4:C
2	1w15:A	132	60	0.0942	0.1364	0.3000	1.3
3	4iu2:A	209	43	0.0733	0.0670	0.3256	1.8	8ajy:A, 8ajy:C, 4iu3:A
4	3fp5:A	106	36	0.0628	0.1132	0.3333	2.2
5	7su3:A	3802	106	0.1414	0.0071	0.2547	2.7
6	8ez9:L	3662	106	0.1518	0.0079	0.2736	3.6	8ez9:C
7	3iqe:A	282	40	0.0733	0.0496	0.3500	3.8	3iqe:D, 3iqe:B, 3iqe:F, 3iqe:C, 3iqe:E, 3iqf:A, 3iqf:D, 3iqf:B, 3iqf:F, 3iqf:C, 3iqf:E, 3iqf:G, 3iqf:J, 3iqf:H, 3iqf:L, 3iqf:I, 3iqf:K, 3iqz:A, 3iqz:D, 3iqz:B, 3iqz:F, 3iqz:C, 3iqz:E
8	8eza:L	3720	106	0.1518	0.0078	0.2736	3.9	8eza:C, 7lt3:C, 7lt3:L
9	7tmv:A	159	63	0.0942	0.1132	0.2857	3.9	7tmv:B
10	4iub:L	602	37	0.0576	0.0183	0.2973	4.3	5d51:L, 4iuc:L, 4iud:L, 5mdj:L, 5mdk:L, 5mdl:L, 7odg:L, 7odh:L, 8pou:L, 8pov:L, 8pow:L, 8pox:L, 8poz:L, 3rgw:L, 4ttt:L
11	6ewz:A	202	107	0.1361	0.1287	0.2430	4.5	6ewz:B, 6ex0:A, 6ex0:B, 6fgx:A, 6fgx:B
12	3izy:P	537	38	0.0785	0.0279	0.3947	5.9
13	7sud:A	3740	105	0.1361	0.0070	0.2476	9.4
14	2yka:A	124	16	0.0471	0.0726	0.5625	9.6

[Back]