AMVNKNKEGLNIDGKEVLAGSTNYYELTWDLDQYKGDKSSKEAIQNGFYYVDDYPEEALDVRPDLVKVADEKGNQVSGVS
VQQYDSLEAAPKKVQDLLKKANITVKGAFQLFSADNPEEFYKQYVATGTSLVITDPMTVKSEFGKTGGKYENKAYQIDFG
NGYATEVVVNNVPKITPKKDVTVSLDPTSENLDGQTVQLYQTFNYRLIGGLIPQNHSEELEDYSFVDDYDQAGDQYTGNY
KTFSSLNLTMKDGSVIKAGTDLTSQTTAETDATNGIVTVRFKEDFLQKISLDSPFQAETYLQMRRIAIGTFENTYVNTVN
KVAYASNTVRTTT
The query sequence (length=333) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7l0o:A | 479 | 324 | 0.9309 | 0.6472 | 0.9568 | 0.0 | 7l0o:B, 2woy:A, 2wqs:A, 2wza:A |
2 | 6e3f:A | 497 | 325 | 0.6697 | 0.4487 | 0.6862 | 1.63e-166 | 3opu:A, 3opu:B, 3opu:C, 3opu:D, 3opu:E, 3opu:F, 3qe5:A, 3qe5:B |
3 | 4tsh:B | 485 | 324 | 0.6096 | 0.4186 | 0.6265 | 1.69e-148 | |
4 | 4ofq:A | 337 | 329 | 0.3514 | 0.3472 | 0.3556 | 5.72e-54 | 4ofq:B |
5 | 8beg:A | 650 | 334 | 0.2913 | 0.1492 | 0.2904 | 7.09e-31 | 8beg:B |
6 | 8beg:A | 650 | 215 | 0.1862 | 0.0954 | 0.2884 | 2.52e-11 | 8beg:B |
7 | 4mng:E | 228 | 59 | 0.0541 | 0.0789 | 0.3051 | 0.35 | 4mng:F |
8 | 3slk:A | 747 | 41 | 0.0511 | 0.0228 | 0.4146 | 1.0 | 3slk:B |
9 | 5d2e:A | 485 | 34 | 0.0300 | 0.0206 | 0.2941 | 2.1 | |
10 | 5y5w:B | 195 | 78 | 0.0601 | 0.1026 | 0.2564 | 2.6 | 7ea1:C, 6i8b:B, 6i8b:E, 6i8l:B, 6i8y:A, 6qpl:B |
11 | 6qti:A | 1038 | 62 | 0.0541 | 0.0173 | 0.2903 | 3.0 | 1d4o:A, 1djl:A, 1djl:B, 1pt9:A, 1pt9:B, 6qti:B, 6que:A, 6que:B, 1u31:A, 1u31:B |
12 | 5mru:A | 173 | 101 | 0.0871 | 0.1676 | 0.2871 | 3.4 | |
13 | 4ayl:A | 210 | 64 | 0.0541 | 0.0857 | 0.2812 | 4.0 | |
14 | 6fbk:A | 83 | 37 | 0.0360 | 0.1446 | 0.3243 | 4.1 | |
15 | 2dy1:A | 660 | 43 | 0.0420 | 0.0212 | 0.3256 | 4.9 | 1wdt:A |
16 | 3cuf:A | 314 | 102 | 0.0661 | 0.0701 | 0.2157 | 5.0 | 3cug:A, 3cuh:A, 3cui:A, 3cuj:A, 1exp:A, 1fh7:A, 1fh8:A, 1fh9:A, 1fhd:A, 2his:A, 1j01:A, 2xyl:A |
17 | 1jtd:B | 273 | 39 | 0.0420 | 0.0513 | 0.3590 | 7.0 | |
18 | 4n0y:L | 212 | 26 | 0.0360 | 0.0566 | 0.4615 | 7.9 | |
19 | 4go4:A | 487 | 41 | 0.0300 | 0.0205 | 0.2439 | 9.6 | 4go4:B, 4go4:C, 4go4:D, 4go4:E, 4go4:F, 4go4:G, 4go4:H |