AMNSTIQTILGHRSIRKFTSQPIDKEQLETILQAGLAASSSSMLQVVSIVRVTDIEKRSQLAKFAGNQAYVESAAEFLVF
CIDYQRHASINPDVQADFTELMLIGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNNAQQVDELLGLPQNTAILFGMCLGH
PDQNPEVKPRLPAHVVVHENQYQDLNLDDIQAYDQTMQNYYANQSTWSQEVTSKLAGESRPHILPYLNGKGLAKK
The query sequence (length=235) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5uu6:C | 236 | 236 | 1.0000 | 0.9958 | 0.9958 | 1.38e-176 | 5uu6:A, 5uu6:B, 5uu6:D |
2 | 1bkj:A | 230 | 233 | 0.8638 | 0.8826 | 0.8712 | 7.78e-154 | 1bkj:B, 2bkj:A, 2bkj:B |
3 | 8ajx:A | 240 | 240 | 0.5106 | 0.5000 | 0.5000 | 4.85e-78 | 1f5v:A, 1f5v:B, 7nb9:A, 7niy:A, 7nmp:A, 7nnx:A, 7q0o:A, 7z0w:A, 7z0w:B, 7z0w:C, 7z0w:D, 7z0w:E, 7z0w:F, 7z0w:G, 7z0w:H |
4 | 5hdj:B | 248 | 248 | 0.4255 | 0.4032 | 0.4032 | 1.17e-62 | 5hdj:A |
5 | 3n2s:A | 248 | 248 | 0.4213 | 0.3992 | 0.3992 | 3.97e-60 | 3n2s:B, 3n2s:C, 3n2s:D |
6 | 1zch:A | 249 | 246 | 0.4000 | 0.3775 | 0.3821 | 3.33e-49 | |
7 | 5hei:A | 246 | 242 | 0.4000 | 0.3821 | 0.3884 | 2.05e-46 | 5hei:B, 5hei:C, 5hei:D, 5hei:E, 5hei:F, 5hei:G, 5hei:H |
8 | 3eof:A | 248 | 199 | 0.2553 | 0.2419 | 0.3015 | 1.46e-23 | 3eof:B |
9 | 4dn2:A | 191 | 191 | 0.2553 | 0.3141 | 0.3141 | 1.69e-19 | 4dn2:B |
10 | 3m5k:A | 168 | 164 | 0.2043 | 0.2857 | 0.2927 | 2.10e-15 | 3m5k:B |
11 | 3kwk:A | 168 | 182 | 0.2000 | 0.2798 | 0.2582 | 3.16e-13 | |
12 | 4g8s:A | 182 | 182 | 0.2043 | 0.2637 | 0.2637 | 7.59e-12 | 4g8s:B |
13 | 3gfa:A | 197 | 188 | 0.2043 | 0.2437 | 0.2553 | 1.11e-10 | 3gfa:B |
14 | 3ge5:A | 176 | 158 | 0.1830 | 0.2443 | 0.2722 | 1.52e-10 | 3ge5:B |
15 | 8cqt:B | 164 | 178 | 0.2085 | 0.2988 | 0.2753 | 3.57e-10 | 8cqt:A |
16 | 5j62:B | 209 | 206 | 0.2383 | 0.2679 | 0.2718 | 2.04e-09 | 5j62:A |
17 | 1nox:A | 200 | 188 | 0.2340 | 0.2750 | 0.2926 | 6.00e-08 | |
18 | 3gr3:A | 226 | 200 | 0.2170 | 0.2257 | 0.2550 | 1.32e-07 | 3gr3:B |
19 | 3e39:A | 175 | 180 | 0.2043 | 0.2743 | 0.2667 | 3.64e-07 | 3e39:B |
20 | 5j6c:A | 173 | 165 | 0.1830 | 0.2486 | 0.2606 | 6.79e-07 | 5j6c:B |
21 | 3ek3:A | 187 | 179 | 0.1660 | 0.2086 | 0.2179 | 1.16e-05 | |
22 | 8uc3:A | 180 | 158 | 0.1915 | 0.2500 | 0.2848 | 3.66e-05 | 8uc3:B |
23 | 2fre:A | 200 | 154 | 0.1745 | 0.2050 | 0.2662 | 5.21e-05 | 2fre:B |
24 | 2isj:A | 219 | 206 | 0.2128 | 0.2283 | 0.2427 | 7.07e-05 | 2isj:B, 2isj:C, 2isj:D, 2isj:E, 2isj:F, 2isj:G, 2isj:H, 2isk:A, 2isk:B, 2isk:C, 2isk:D, 2isk:E, 2isk:F, 2isk:G, 2isk:H, 2isl:A, 2isl:B, 2isl:C, 2isl:D, 2isl:E, 2isl:F, 2isl:G, 2isl:H |
25 | 3e10:B | 167 | 159 | 0.1489 | 0.2096 | 0.2201 | 7.13e-04 | 3e10:A |
26 | 3eo7:A | 487 | 55 | 0.0894 | 0.0431 | 0.3818 | 0.001 | |
27 | 3pxv:B | 189 | 74 | 0.1064 | 0.1323 | 0.3378 | 0.011 | 3pxv:A, 3pxv:C, 3pxv:D |
28 | 2i7h:A | 187 | 184 | 0.1745 | 0.2193 | 0.2228 | 0.011 | 2i7h:B, 2i7h:C, 2i7h:D |
29 | 2r01:A | 195 | 60 | 0.0809 | 0.0974 | 0.3167 | 0.016 | |
30 | 3gbh:B | 213 | 200 | 0.1617 | 0.1784 | 0.1900 | 0.042 | 3gbh:A, 3gbh:C, 3gbh:D |
31 | 4xoq:A | 204 | 191 | 0.2000 | 0.2304 | 0.2461 | 0.049 | 4xoo:A, 4xoo:B, 4xoo:C, 4xoo:D, 4xoq:B, 4xoq:C, 4xoq:D |
32 | 8cqs:B | 194 | 96 | 0.1191 | 0.1443 | 0.2917 | 0.11 | 8cqs:A |
33 | 3hoi:A | 193 | 64 | 0.0936 | 0.1140 | 0.3438 | 0.18 | |
34 | 3hj9:A | 215 | 177 | 0.1830 | 0.2000 | 0.2429 | 0.33 | 3hj9:B |
35 | 5ko7:B | 200 | 154 | 0.1617 | 0.1900 | 0.2468 | 0.51 | |
36 | 3qdl:A | 178 | 115 | 0.1362 | 0.1798 | 0.2783 | 0.68 | 3qdl:B, 3qdl:C, 3qdl:D |
37 | 7dp0:A | 223 | 50 | 0.0681 | 0.0717 | 0.3200 | 0.69 | 7dp0:B, 7dp1:A, 7dp1:B, 7dp2:A, 7dp2:B |
38 | 6sdk:A | 199 | 49 | 0.0766 | 0.0905 | 0.3673 | 0.81 | 6sdk:B, 6sdk:C, 6sdk:D |
39 | 3bm1:A | 177 | 174 | 0.1660 | 0.2203 | 0.2241 | 1.8 | 3bm1:B |
40 | 7tmf:B | 183 | 63 | 0.0894 | 0.1148 | 0.3333 | 2.1 | 7tmf:A, 7tmg:A, 7tmg:B |
41 | 5ko8:B | 218 | 58 | 0.0596 | 0.0642 | 0.2414 | 2.3 | 5ko7:A, 5ko8:A, 5krd:A, 5krd:B |