AMNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHAANVPAFVSGKALKDAVK
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yew:C | 71 | 72 | 0.9589 | 0.9859 | 0.9722 | 4.35e-43 | 6o6k:B, 6oaj:D, 4yex:C, 4yft:C |
2 | 6oaj:B | 79 | 79 | 0.9726 | 0.8987 | 0.8987 | 8.03e-43 | 6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A |
3 | 6o8q:B | 91 | 90 | 0.9863 | 0.7912 | 0.8000 | 1.35e-41 | 6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B |
4 | 4qju:A | 90 | 90 | 0.5342 | 0.4333 | 0.4333 | 4.49e-18 | 4qju:B |
5 | 1p71:A | 94 | 89 | 0.4932 | 0.3830 | 0.4045 | 8.04e-14 | 1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B |
6 | 4dky:B | 101 | 51 | 0.2877 | 0.2079 | 0.4118 | 5.16e-09 | |
7 | 8flj:F | 94 | 91 | 0.3288 | 0.2553 | 0.2637 | 1.25e-07 | 8flj:H |
8 | 2iie:A | 204 | 61 | 0.2466 | 0.0882 | 0.2951 | 8.63e-04 | 2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K |
9 | 8flj:G | 98 | 61 | 0.2329 | 0.1735 | 0.2787 | 0.001 | 8flj:E |
10 | 6nvo:A | 200 | 46 | 0.2055 | 0.0750 | 0.3261 | 2.8 | 6nvp:A |
11 | 5m7i:A | 425 | 54 | 0.2055 | 0.0353 | 0.2778 | 3.7 | 5m7y:A, 3qt9:A, 6rqk:A, 6rqk:B |