AMLPTLRTGLVIAAGYADKVRRVLFAQLRDAIKSGELSNKDVAMAAGNLNRVLFELLVNKLKADKLDVVRIQIDYEVRDS
QIQFDFSTLRVELWRRVPEEEIAPIVEDFARAAPRLLEEEIRFTVEKVGETDVGDVVYRIMYRGSDVGALIVTPLNGEAL
VRGAVVEPTPLLLKRTRVQVEADRIDDFVRESVSRLFSEAQNVEKREAVRVVNEILSLV
The query sequence (length=219) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pso:I | 221 | 219 | 1.0000 | 0.9910 | 1.0000 | 5.61e-155 | 4pso:A, 4pso:B, 4pso:C, 4pso:D, 4pso:F, 4pso:G, 4pso:H |
2 | 5a7i:A | 313 | 78 | 0.0868 | 0.0607 | 0.2436 | 0.43 | 5a7j:A, 5a7j:B, 4cml:A, 3mtc:A, 3n9v:A, 3n9v:B |
3 | 7aju:CE | 436 | 78 | 0.1096 | 0.0550 | 0.3077 | 1.1 | 7ajt:CE, 7d4i:3E, 7d5s:3E, 7d5t:3E, 7d63:3E, 6ke6:3E, 6lqp:3E, 6lqq:3E, 6lqr:3E, 6lqs:3E, 6lqt:3E, 6lqu:3E, 6lqv:3E, 7suk:SB, 5wyj:3E, 5wyk:3E, 6zqa:CE, 6zqb:CE, 6zqc:CE, 6zqd:CE, 6zqe:CE |
4 | 7f7a:A | 254 | 39 | 0.0502 | 0.0433 | 0.2821 | 3.7 | 7cle:A, 7f7b:A, 7f7c:A, 7f7d:A |
5 | 8dgf:A | 1541 | 49 | 0.0685 | 0.0097 | 0.3061 | 7.6 | 8dgf:B, 8dgf:C, 8dgf:D |