BioLiP

>protein
AMINLHIQKDNPKIVHAFDMEDLGGKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ew0:A	77	65	0.9846	0.8312	0.9846	2.88e-44	6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A
2	3fnv:B	68	66	0.7077	0.6765	0.6970	1.29e-30	3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D
3	7yvz:A	63	62	0.5846	0.6032	0.6129	2.12e-25
4	3s2r:B	78	63	0.4769	0.3974	0.4921	2.09e-17	3s2q:A, 3s2q:B, 3s2r:A
5	3tbm:A	61	23	0.1846	0.1967	0.5217	0.014	3tbm:B
6	3tbn:A	87	17	0.1692	0.1264	0.6471	0.038
7	3tbn:A	87	26	0.1846	0.1379	0.4615	0.12
8	6avj:A	92	47	0.3077	0.2174	0.4255	0.042	6avj:B, 6avj:C
9	3tbo:A	54	22	0.1846	0.2222	0.5455	0.35
10	5tbd:G	112	33	0.2000	0.1161	0.3939	1.7	5tbd:F, 5tbd:B, 5tbd:K
11	1gqb:A	131	33	0.1538	0.0763	0.3030	2.5	1gqb:B
12	6z1p:AV	129	20	0.1538	0.0775	0.5000	4.9
13	8any:e	238	51	0.2308	0.0630	0.2941	5.4	3j7y:e, 7odr:e, 7ods:e, 7odt:e, 8oir:Bv, 8oit:Bv, 8pk0:e, 7po4:e, 7qi4:e, 7qi5:e, 7qi6:e, 8qsj:e, 6zm5:e, 6zm6:e
14	2xn2:A	729	60	0.2462	0.0219	0.2667	5.6
15	8esz:S1	683	41	0.2154	0.0205	0.3415	6.4	8b9z:G, 8ba0:G, 8esw:S1
16	1is3:A	134	12	0.1385	0.0672	0.7500	9.2	1is4:A, 1wld:A, 1wlw:A

[Back]