BioLiP

>protein
AMINLHIQKDNPKIVHAFDGEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKK

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ew0:A	77	64	0.9844	0.8182	0.9844	3.23e-43	6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A
2	3fnv:B	68	65	0.7031	0.6618	0.6923	4.01e-29	3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D
3	7yvz:A	63	62	0.5938	0.6032	0.6129	6.17e-25
4	3s2r:B	78	63	0.4844	0.3974	0.4921	7.48e-17	3s2q:A, 3s2q:B, 3s2r:A
5	3tbn:A	87	17	0.1719	0.1264	0.6471	0.041
6	3tbn:A	87	24	0.1719	0.1264	0.4583	1.1
7	3tbm:A	61	22	0.1719	0.1803	0.5000	0.094	3tbm:B
8	6avj:A	92	21	0.1875	0.1304	0.5714	0.26	6avj:B, 6avj:C
9	3tbo:A	54	22	0.1875	0.2222	0.5455	0.41
10	5tbd:G	112	33	0.2031	0.1161	0.3939	1.3	5tbd:F, 5tbd:B, 5tbd:K
11	6z1p:AV	129	31	0.1875	0.0930	0.3871	1.6
12	2xn2:A	729	60	0.2500	0.0219	0.2667	6.5
13	7bkb:B	296	35	0.1406	0.0304	0.2571	8.4	7bkb:b, 7bkc:B, 7bkc:b, 7bkd:B, 7bkd:b, 7bke:B, 7bke:b
14	1is3:A	134	12	0.1406	0.0672	0.7500	9.8	1is4:A, 1wld:A, 1wlw:A

[Back]