AMHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTDQDV
QWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPF
KAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLT
GNIVAGNPRVVKAMLANMRDELSDALK
The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ib8:B | 270 | 267 | 1.0000 | 0.9889 | 1.0000 | 0.0 | 6ib7:A, 6ib8:A, 2qfl:A, 6tqn:T, 6tqn:S, 6tqo:T, 6tqo:S |
2 | 8wdq:A | 273 | 271 | 0.5543 | 0.5421 | 0.5461 | 2.57e-101 | 8wdq:B |
3 | 3lv0:A | 258 | 246 | 0.4045 | 0.4186 | 0.4390 | 3.64e-64 | 3luz:A, 3lv0:B |
4 | 3luz:B | 234 | 246 | 0.3783 | 0.4316 | 0.4106 | 1.31e-54 | |
5 | 2p3n:A | 256 | 246 | 0.3483 | 0.3633 | 0.3780 | 2.11e-48 | 2p3n:B, 2p3n:C, 2p3n:D |
6 | 6giu:A | 275 | 257 | 0.3146 | 0.3055 | 0.3268 | 3.16e-45 | 4as4:A, 4as4:B, 1awb:A, 1awb:B, 6giu:B, 6gj0:A, 6gj0:B, 2hhm:A, 2hhm:B, 1ima:A, 1ima:B, 1imb:A, 1imb:B, 1imc:A, 1imc:B, 1imd:A, 1imd:B, 1ime:A, 1ime:B, 6zk0:AAA, 6zk0:BBB |
7 | 2czi:A | 259 | 251 | 0.3184 | 0.3282 | 0.3386 | 9.90e-44 | 2czh:B |
8 | 4as5:A | 274 | 249 | 0.3034 | 0.2956 | 0.3253 | 1.58e-42 | 4as5:B, 4as5:C, 4as5:D |
9 | 2bji:A | 274 | 259 | 0.3146 | 0.3066 | 0.3243 | 1.50e-40 | 2bji:B |
10 | 5dw8:A | 260 | 217 | 0.2921 | 0.3000 | 0.3594 | 1.40e-36 | 5dw8:B, 5j16:A, 5j16:B, 5j16:C, 5j16:D |
11 | 5eyg:B | 265 | 183 | 0.1985 | 0.2000 | 0.2896 | 1.08e-23 | 5eyg:A, 5eyh:A, 5eyh:B, 5f24:A, 5f24:B, 4g61:A, 4g61:B, 4i3e:A, 4i3e:B, 4i3y:A, 4i3y:B, 4i40:A, 4i40:B, 4ptk:A, 4ptk:B, 3ryd:A, 3ryd:C |
12 | 5eq9:B | 260 | 231 | 0.2472 | 0.2538 | 0.2857 | 3.16e-21 | 5eq8:A, 5eq9:A, 5eq9:C, 5eq9:D, 5t3j:A |
13 | 1dk4:A | 252 | 194 | 0.2022 | 0.2143 | 0.2784 | 2.46e-17 | 1dk4:B, 1g0h:A, 1g0h:B, 1g0i:A, 1g0i:B |
14 | 5zon:A | 256 | 202 | 0.2247 | 0.2344 | 0.2970 | 1.55e-13 | 5yht:A, 5yht:B, 5zon:B, 5zon:C, 5zon:D |
15 | 6b5z:A | 252 | 229 | 0.2622 | 0.2778 | 0.3057 | 2.77e-13 | 6b5z:B, 6b60:A, 6b60:B, 6b61:A, 6b61:B, 6b62:A, 6b62:B, 6b63:A, 6b63:B, 6b64:A, 6b64:B, 6b65:A, 6b65:B, 6b66:A, 6b66:B, 1lbx:A, 1lbx:B, 1lby:A, 1lby:B, 1lbz:A, 1lbz:B |
16 | 4hxv:A | 317 | 206 | 0.2060 | 0.1735 | 0.2670 | 2.92e-09 | 4o7i:A |
17 | 8f9y:A | 352 | 288 | 0.2734 | 0.2074 | 0.2535 | 1.92e-08 | |
18 | 2wef:A | 303 | 264 | 0.2509 | 0.2211 | 0.2538 | 2.78e-08 | 1jp4:A |
19 | 1k9y:A | 354 | 357 | 0.2959 | 0.2232 | 0.2213 | 1.96e-06 | 1k9z:A, 1ka0:A, 1ka1:A, 1qgx:A |
20 | 5djj:A | 257 | 87 | 0.0936 | 0.0973 | 0.2874 | 0.017 | 5djg:A, 5djh:A, 5dji:A, 5djk:A |
21 | 5q0c:A | 328 | 86 | 0.0861 | 0.0701 | 0.2674 | 0.13 | 5et6:A, 5et6:C, 5et6:B, 5et6:D, 4he0:A, 4he1:A, 4he2:A, 3ifa:A, 3ifa:B, 3ifa:C, 3ifa:D, 3ifc:A, 3ifc:B, 3ifc:C, 3ifc:D, 5k56:A, 5l0a:A, 5q0c:B, 5q0c:C, 5q0c:D, 5q0c:E, 5q0c:F, 5q0c:G, 5q0c:H |
22 | 8de5:A | 338 | 126 | 0.1386 | 0.1095 | 0.2937 | 0.33 | |
23 | 5o9z:L | 459 | 41 | 0.0562 | 0.0327 | 0.3659 | 1.9 | |
24 | 2wnb:A | 273 | 126 | 0.1049 | 0.1026 | 0.2222 | 2.3 | 2wnf:A |
25 | 1ee9:A | 317 | 64 | 0.0712 | 0.0599 | 0.2969 | 2.9 | |
26 | 4oal:A | 444 | 61 | 0.0524 | 0.0315 | 0.2295 | 2.9 | 4oal:B |
27 | 9enp:A | 1072 | 135 | 0.1461 | 0.0364 | 0.2889 | 3.3 | 9enq:A, 8oja:A |
28 | 8v1t:A | 1064 | 147 | 0.1573 | 0.0395 | 0.2857 | 4.1 | |
29 | 5k55:A | 290 | 65 | 0.0562 | 0.0517 | 0.2308 | 4.5 | 5et8:A |
30 | 5fm6:A | 426 | 40 | 0.0562 | 0.0352 | 0.3750 | 4.8 | 5fm7:A, 4ww4:A |
31 | 8av6:C | 459 | 40 | 0.0562 | 0.0327 | 0.3750 | 5.2 | 8av6:A, 8av6:B, 6fhs:A, 6fhs:B, 6fhs:C, 6fml:A, 6fml:B, 6fml:C, 8oo7:A, 8oo7:B, 8oo7:C, 8ooc:A, 8ooc:B, 8ooc:C, 8oop:A, 8oop:B, 8oop:C, 8oor:A, 8oor:B, 8oor:C, 4wvy:A |
32 | 5yjl:B | 415 | 69 | 0.1011 | 0.0651 | 0.3913 | 5.2 | 5yjl:A |
33 | 8v1q:A | 1097 | 149 | 0.1573 | 0.0383 | 0.2819 | 6.2 | 8exx:A, 7luf:A, 7luf:B, 8oj6:A, 8oj7:A, 8ojb:A, 8ojd:A, 8v1r:A, 8v1s:A, 8vq2:A, 8vq2:B |
34 | 3e4d:A | 278 | 19 | 0.0375 | 0.0360 | 0.5263 | 7.0 | 3e4d:B, 3e4d:C, 3e4d:E, 3e4d:D, 3e4d:F |
35 | 3ojl:A | 418 | 84 | 0.0749 | 0.0478 | 0.2381 | 9.9 | 3ojl:B, 3ojo:A, 3ojo:B |