BioLiP

>protein
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYF
GGRVVKACFYNLDKFRVLDLAEQV

The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6hip:A	104	104	1.0000	1.0000	1.0000	3.73e-71	6hip:B, 5lso:A, 5lso:B, 2peh:A, 2peh:B
2	6slo:A	214	98	0.3750	0.1822	0.3980	1.86e-17	6lur:B, 6lur:C, 6lur:D, 6lur:A, 6lur:E, 6slo:C, 6slo:D
3	7evo:D	200	90	0.2788	0.1450	0.3222	3.37e-05	8hk1:D, 6n3e:A, 6n3f:C, 6nsx:A
4	1jmt:A	98	54	0.2019	0.2143	0.3889	5.53e-05
5	7sn6:B	105	77	0.2596	0.2571	0.3506	1.99e-04	1o0p:A, 1opi:A, 7sn6:A
6	7c06:A	193	65	0.2115	0.1140	0.3385	0.015	7c06:G, 7c06:D, 7c06:J, 7c06:M, 7c06:P, 7c06:S, 7c06:V, 7c06:Y, 7c07:A, 7c07:G, 7c07:D, 7c07:J, 7c07:M, 7c07:P, 7c07:S, 7c07:V, 7c07:Y, 7c08:A, 7c08:G, 7c08:D, 7c08:J, 7c08:M, 7c08:P, 7c08:S, 7c08:V, 7c08:Y, 4yh8:A
7	2x1f:A	94	36	0.1442	0.1596	0.4167	0.089	2km8:B, 2x1a:A
8	7qde:B	169	34	0.1154	0.0710	0.3529	0.21	7qdd:B
9	5cxt:K	113	99	0.2596	0.2389	0.2727	0.24	5cxt:A, 5cxt:C, 5cxt:E, 5cxt:G, 5cxt:I, 5cxt:M, 5cxt:O, 5cxt:Q, 4oz1:B, 4oz1:A, 4ru2:A, 4ru2:C, 4ru2:E, 4ru2:G, 4ru2:I, 4ru2:K, 4ru2:M, 4ru2:O, 4ru2:Q
10	2mqp:A	118	45	0.1635	0.1441	0.3778	0.54	7evr:A, 7evr:C
11	7dco:X	128	34	0.1442	0.1172	0.4412	0.93	5gm6:V, 5zwm:X
12	7evs:A	101	45	0.1731	0.1782	0.4000	1.1	7evs:B
13	2mkc:A	118	34	0.1442	0.1271	0.4412	1.3	2my3:A
14	1c9k:B	180	21	0.1154	0.0667	0.5714	1.8	1c9k:A, 1c9k:C
15	3c5i:D	355	79	0.2404	0.0704	0.3165	3.2	3c5i:C, 3c5i:A, 3c5i:B
16	5erp:A	443	22	0.0865	0.0203	0.4091	3.3	5erp:B
17	8h6e:4R	106	28	0.0865	0.0849	0.3214	3.8	8h6j:4R, 8qp8:R, 8qp9:R, 8qpk:R, 6qw6:R, 6qx9:R, 8qxd:R, 8r08:R, 8r0a:R
18	2fy1:A	108	28	0.0962	0.0926	0.3571	4.0
19	5kw6:A	201	74	0.1731	0.0896	0.2432	4.3	5kvy:A, 5kvy:B, 5kw1:A, 5kw1:B, 5kw6:B, 7q8a:B, 7q8a:A, 2qfj:A, 2qfj:B, 7z3x:A, 7z3x:B
20	4f1n:B	853	38	0.1154	0.0141	0.3158	6.1
21	4f1n:A	904	38	0.1154	0.0133	0.3158	6.1	5the:A, 5the:C, 5the:E, 5the:G
22	4h19:A	372	29	0.0962	0.0269	0.3448	6.1	4h19:B, 4h19:C, 4h19:D, 4h19:F, 4h19:E, 4h19:G, 4h19:H, 4h19:I, 4h19:K, 4h19:L, 4h19:M, 4h19:N, 4h19:P, 4h19:J, 4h19:O
23	7bew:A	330	88	0.1827	0.0576	0.2159	6.9	7bex:A
24	6tp5:A	370	59	0.1538	0.0432	0.2712	7.5	6tp5:B
25	6hpd:A	955	37	0.1346	0.0147	0.3784	7.7
26	4wsi:A	372	52	0.1538	0.0430	0.3077	8.1	7m4r:A, 7ntj:B, 7ntj:A, 7ntk:A, 7ntk:D, 7ntk:B, 7ntk:F, 7qcs:A, 7qcs:B, 4uu5:A, 4wsi:B
27	7rbq:A	614	25	0.1250	0.0212	0.5200	8.5	7t39:A
28	4m54:A	310	46	0.1154	0.0387	0.2609	9.6

[Back]