AMDKSAKAPVITIFDHRGCSRAPKEYTGSKASGQDDEMMVKAQSVKIAVSDGVAESVLKDSLSVMHK
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7tja:G | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 4.23e-44 | 7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O |
2 | 1qgw:B | 67 | 67 | 0.8209 | 0.8209 | 0.8209 | 9.26e-35 | 1xf6:B, 1xg0:B |
3 | 1qgw:A | 76 | 64 | 0.6418 | 0.5658 | 0.6719 | 2.91e-25 | 1xf6:A, 1xg0:A |
4 | 7t8s:D | 70 | 69 | 0.6119 | 0.5857 | 0.5942 | 4.16e-23 | 7t8s:H, 7t8s:L, 7t8s:P |
5 | 7tja:I | 75 | 67 | 0.5821 | 0.5200 | 0.5821 | 7.95e-21 | 7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M |
6 | 7t8s:B | 78 | 64 | 0.5672 | 0.4872 | 0.5938 | 4.15e-18 | 7t8s:F, 7t8s:J, 7t8s:N |
7 | 7sut:C | 63 | 60 | 0.4627 | 0.4921 | 0.5167 | 3.45e-14 | 7sut:G |
8 | 7t7u:C | 70 | 66 | 0.4925 | 0.4714 | 0.5000 | 7.80e-14 | |
9 | 4lms:C | 68 | 65 | 0.4925 | 0.4853 | 0.5077 | 1.53e-13 | |
10 | 7t7u:A | 81 | 64 | 0.3881 | 0.3210 | 0.4062 | 7.55e-12 | |
11 | 4lms:A | 80 | 60 | 0.3284 | 0.2750 | 0.3667 | 7.82e-09 | |
12 | 7sut:A | 78 | 47 | 0.2388 | 0.2051 | 0.3404 | 5.56e-05 | 7sut:E |
13 | 7ssf:A | 72 | 58 | 0.3284 | 0.3056 | 0.3793 | 2.05e-04 | 7ssf:C, 7ssf:E, 7ssf:G |
14 | 7s96:A | 63 | 58 | 0.3284 | 0.3492 | 0.3793 | 0.001 | 7s96:C, 7s97:C, 7t89:A, 7t89:C |
15 | 4lmx:C | 66 | 61 | 0.3731 | 0.3788 | 0.4098 | 0.002 | 8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F |
16 | 4lmx:E | 66 | 61 | 0.3731 | 0.3788 | 0.4098 | 0.003 | 8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K |
17 | 4lm6:A | 62 | 57 | 0.2836 | 0.3065 | 0.3333 | 0.95 | 4lm6:C |
18 | 2j7a:B | 498 | 26 | 0.1642 | 0.0221 | 0.4231 | 3.2 | 2j7a:A, 2j7a:D, 2j7a:E, 2j7a:G, 2j7a:H, 2j7a:J, 2j7a:K, 2j7a:M, 2j7a:N, 2j7a:P, 2j7a:Q, 2vr0:A, 2vr0:B, 2vr0:D, 2vr0:E |
19 | 9iq9:B | 275 | 43 | 0.2090 | 0.0509 | 0.3256 | 6.4 | 7euk:A, 7euk:B, 7eul:A, 7eun:A, 7eun:B, 7euq:A, 7euq:B, 9iq9:A, 8ius:A, 8ius:B, 8iut:A, 8iut:B, 8iuu:A, 8iuu:B, 8iuv:A, 8iuv:B, 8iuw:A, 8iuw:B, 6lug:A, 6lug:B, 6luh:A, 6luh:B |