BioLiP

>protein
AMDIVFIEELSVITTIYDWEQTIQQKLVFDIEMGWDNRKAADDVNDCLSYADISEAVIQHVGSQRFALVERVAEEVAELL
LRRFNSPWVRIKVSKPGAVAQAKNVGVIIERGQ

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7su7:D	119	117	1.0000	0.9496	0.9658	5.84e-76	6ojo:A, 6ojo:C, 6ojo:B, 6ojo:D, 7su4:A, 7su4:D, 7su4:B, 7su4:C, 7su6:A, 7su6:C, 7su6:B, 7su6:D, 7su7:B, 7su7:A, 7su7:C, 7su8:A, 7su8:B
2	2o90:A	115	115	0.8496	0.8348	0.8348	1.28e-63
3	5f3m:A	120	114	0.2478	0.2333	0.2456	8.12e-05	5f3m:B, 5far:A, 5far:B, 5far:C, 5far:D, 5far:E, 5far:H, 5far:F, 5far:G, 8sv5:A, 8sv5:G, 8sv5:B, 8sv5:H, 8sv5:C, 8sv5:D, 8sv5:F, 8sv5:E
4	1nbu:A	118	102	0.2566	0.2458	0.2843	0.002	1nbu:D, 1nbu:B, 1nbu:C, 1nbu:E, 1nbu:H, 1nbu:F, 1nbu:G
5	4xeq:B	304	34	0.1239	0.0461	0.4118	0.99	4xeq:A, 4xeq:C, 4xeq:D
6	1kgz:B	330	86	0.2124	0.0727	0.2791	1.3	1kgz:A
7	3zyp:A	218	74	0.1416	0.0734	0.2162	1.8
8	3zqj:D	921	63	0.1858	0.0228	0.3333	4.8	3zqj:B, 3zqj:E
9	3oib:A	381	47	0.1416	0.0420	0.3404	5.8	3oib:B, 3p4t:A, 3p4t:B
10	7qoe:A	187	40	0.1062	0.0642	0.3000	5.9
11	4qpe:A	867	82	0.2124	0.0277	0.2927	8.1	5dyf:A, 2gtq:A, 4pu2:A, 4pvb:A, 4pw4:A, 4qhp:A, 4qir:A, 4qme:A, 4quo:A
12	8psn:A	417	46	0.1327	0.0360	0.3261	9.0	8pso:A, 8psq:A, 8pss:A, 8psu:A, 8psx:A, 8psz:A, 8pt2:A, 8pt6:A, 8pt7:A, 8pth:A, 8ptj:A, 8qz8:A

[Back]