AMDARSVNGEFPRHVKLKNEIENLLDQVTQLYTKHNSNYQQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKV
LGKVAFEKDDLEKEVKELKEKIDKKE
The query sequence (length=106) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8p6j:CCC | 106 | 105 | 0.9906 | 0.9906 | 1.0000 | 3.94e-72 | 8p6j:BBB, 8p6j:FFF |
2 | 6c7n:D | 389 | 68 | 0.1792 | 0.0488 | 0.2794 | 0.30 | |
3 | 8h68:A | 624 | 76 | 0.1887 | 0.0321 | 0.2632 | 0.46 | 8hb2:A, 8hb2:B, 8hb2:C, 8hb2:D, 8hbb:A, 8hbb:B, 8hbb:C, 8hbb:D |
4 | 3j5s:D | 554 | 81 | 0.1981 | 0.0379 | 0.2593 | 0.55 | |
5 | 7auk:A | 168 | 43 | 0.1415 | 0.0893 | 0.3488 | 0.76 | 7aui:A, 7auj:A, 7aul:A, 7aum:A, 7aun:A, 7aup:A, 7aus:A |
6 | 7auo:A | 149 | 43 | 0.1415 | 0.1007 | 0.3488 | 0.95 | 7auq:A, 7aur:A, 7auu:A |
7 | 3zha:A | 380 | 29 | 0.0943 | 0.0263 | 0.3448 | 1.0 | 4au2:A, 4au2:B, 4au2:D, 4au3:A, 4au3:B, 4au3:C, 4au3:D, 7bdu:A, 7bdu:B, 7bee:A, 7bee:B, 7bfi:A, 7bfi:C, 7bfi:D, 7bfi:B, 3zha:B, 3zha:C, 3zha:D, 3zha:K, 3zha:L, 3zha:P, 3zha:Q |
8 | 5gvh:A | 311 | 26 | 0.1038 | 0.0354 | 0.4231 | 1.2 | |
9 | 7t7n:B | 440 | 82 | 0.2075 | 0.0500 | 0.2683 | 1.2 | 8tkz:B |
10 | 6c7n:A | 553 | 68 | 0.1792 | 0.0344 | 0.2794 | 1.3 | 6c7n:B, 6c7n:C |
11 | 8v5r:A | 944 | 76 | 0.2170 | 0.0244 | 0.3026 | 1.8 | 8g5i:A, 8g5l:A, 8g5m:A, 8g5n:A, 8g5o:A, 8g5p:A, 8t7e:A |
12 | 3zs7:A | 277 | 76 | 0.2358 | 0.0903 | 0.3289 | 1.9 | |
13 | 6a0q:B | 315 | 22 | 0.1038 | 0.0349 | 0.5000 | 2.1 | |
14 | 6u3e:A | 397 | 91 | 0.2358 | 0.0630 | 0.2747 | 3.7 | 6u3e:B, 6u3g:A, 6u3g:B |
15 | 8d33:A | 974 | 74 | 0.2075 | 0.0226 | 0.2973 | 4.0 | 8d37:A, 8d3r:A, 8d42:A, 8udl:A, 8v54:A |
16 | 8udk:A | 1012 | 74 | 0.2075 | 0.0217 | 0.2973 | 4.7 | 5c51:A, 5c52:A, 5c53:A, 4ztu:A, 4ztz:A |
17 | 4v8p:BB | 386 | 49 | 0.1981 | 0.0544 | 0.4286 | 5.1 | 4v8p:CB, 4v8p:EB, 4v8p:GB |
18 | 8g5j:A | 941 | 74 | 0.2075 | 0.0234 | 0.2973 | 5.8 | |
19 | 4u5x:A | 178 | 39 | 0.1226 | 0.0730 | 0.3333 | 6.8 | |
20 | 2xr1:B | 611 | 59 | 0.1604 | 0.0278 | 0.2881 | 8.4 | 2xr1:A |
21 | 5faw:B | 806 | 24 | 0.1226 | 0.0161 | 0.5417 | 9.5 | 5fau:A, 5fau:B, 5fau:C, 5fau:D, 5faw:A, 5fay:A, 5fay:B, 6nd3:A, 6nd3:B, 6nd3:C, 6nd3:D, 6nd3:E, 6nd3:F, 6nd3:G, 6nd3:H, 6vue:A, 6vue:B |