AMALIEVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAAN
TKSAANLKVKEL
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1waa:C | 93 | 92 | 1.0000 | 0.9892 | 1.0000 | 2.87e-64 | 1waa:A, 1waa:B, 1waa:D, 1waa:E, 1waa:F |
2 | 5jdj:B | 91 | 89 | 0.3043 | 0.3077 | 0.3146 | 1.00e-07 | 5jdj:E, 5jdj:I, 5jdj:L, 4qeg:A |
3 | 8rih:B | 333 | 46 | 0.1848 | 0.0511 | 0.3696 | 0.52 | 8rih:A |
4 | 4zgf:A | 141 | 72 | 0.2065 | 0.1348 | 0.2639 | 2.4 | |
5 | 5koi:A | 271 | 41 | 0.1196 | 0.0406 | 0.2683 | 3.1 | 5koi:B, 5koi:C, 5koi:D, 5koi:E, 5koi:F, 5koi:G, 5koi:H |
6 | 1i1a:C | 205 | 13 | 0.0761 | 0.0341 | 0.5385 | 4.3 | 1i1c:A |
7 | 6bbx:A | 121 | 21 | 0.0978 | 0.0744 | 0.4286 | 6.0 | 6bbx:B, 5ujp:A, 5ujp:B, 5umx:A, 5umx:B, 5umy:A, 5umy:B, 5w27:A, 5w27:B |
8 | 9b4h:A | 1908 | 44 | 0.1304 | 0.0063 | 0.2727 | 6.7 | 9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E |
9 | 3lst:A | 333 | 41 | 0.1739 | 0.0480 | 0.3902 | 7.7 | 3lst:B |
10 | 5xbx:A | 179 | 23 | 0.0870 | 0.0447 | 0.3478 | 8.7 | 5xc4:A, 5xc8:A, 5xc9:A, 5xca:A |