AMAKQTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVTELGSTKIIQ
THGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFLTR
DHEVYPGLSKEFSR
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ck2:A | 174 | 174 | 1.0000 | 1.0000 | 1.0000 | 4.37e-131 | |
2 | 1su1:A | 184 | 64 | 0.1379 | 0.1304 | 0.3750 | 1.14e-05 | 1su1:B, 1su1:C, 1su1:D |
3 | 5xch:A | 180 | 81 | 0.1494 | 0.1444 | 0.3210 | 2.45e-04 | 5xch:B |
4 | 8tta:C | 188 | 81 | 0.1322 | 0.1223 | 0.2840 | 3.66e-04 | 8ese:Z, 8fud:A, 8fud:B, 5gtu:A, 5osi:A, 5osi:D, 5osi:G, 3psn:A, 3psn:B, 3pso:A, 3pso:B, 8r02:B, 8rks:A, 8rks:E, 8rks:G, 8rks:C, 8tta:A, 8ttd:A, 6xs5:A, 6xs7:A, 6xs9:A, 6xs9:B, 6xsa:A, 1z2w:A, 1z2w:B |
5 | 3qfm:A | 258 | 115 | 0.1954 | 0.1318 | 0.2957 | 0.20 | 3qfm:B, 3qfn:A, 3qfn:B, 3qfo:A, 3qfo:B |
6 | 1qjs:A | 408 | 28 | 0.0690 | 0.0294 | 0.4286 | 3.0 | 1qhu:A, 1qjs:B |
7 | 1ci0:A | 205 | 31 | 0.0690 | 0.0585 | 0.3871 | 4.7 | 1ci0:B |
8 | 6zcv:A | 562 | 56 | 0.0920 | 0.0285 | 0.2857 | 4.8 | 6zcw:A |
9 | 1s0u:A | 391 | 140 | 0.2241 | 0.0997 | 0.2786 | 5.9 | |
10 | 3rqz:C | 245 | 85 | 0.1207 | 0.0857 | 0.2471 | 9.3 | 3rqz:A, 3rqz:B |