BioLiP

>protein
AMADREKLLTESGVYGTFATFQMDHDWWDLPGESRVISVAEVKGLVEQWSGKILVESYLLRGLSDHADLMFRVHARTLSD
TQQFLSAFMGTRLGRHLTSGGLLHGVSKKPTYVAGFPESMKTELQVNGESGSRPYAIVIPIKKDAEWWALDQEARTALMQ
EHTQAALPYLKTVKEKLYHSTGLDDVDFITYFETERLEDFHNLVRALQQVKEFRHNRRFGHPTLLGTMSPLDEILEKFAQ

The query sequence (length=240) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4m05:B	240	240	1.0000	1.0000	1.0000	0.0	4m05:A, 4m05:C, 4m05:D, 4m05:E, 4m06:A, 4m06:B, 4m06:C, 4m06:D, 4m06:E, 4m07:A, 4m07:B, 4m07:C, 4m07:D, 4m07:E, 4m08:A, 4m08:B, 4m08:C, 4m08:D, 4m08:E, 4m09:A, 4m09:B, 4m09:C, 4m09:D, 4m09:E, 3nn1:A, 3nn1:B, 3nn1:C, 3nn1:D, 3nn1:E, 3nn2:A, 3nn2:B, 3nn2:C, 3nn2:D, 3nn2:E, 3nn3:A, 3nn3:B, 3nn3:C, 3nn3:D, 3nn3:E, 3nn4:A, 3nn4:B, 3nn4:C, 3nn4:D, 3nn4:E
2	3q08:A	241	238	0.4125	0.4108	0.4160	6.56e-59	3q08:B, 3q08:C, 3q08:D, 3q08:E, 3q08:F, 3q08:G, 3q08:H, 3q08:I, 3q08:J, 3q08:K, 3q08:L, 3q08:M, 3q08:N, 3q08:O, 3q08:P, 3q08:Q, 3q08:R, 3q08:S, 3q08:T, 3q09:A, 3q09:B, 3q09:C, 3q09:D, 3q09:E, 3q09:F, 3q09:G, 3q09:H, 3q09:I, 3q09:J, 3q09:K, 3q09:L, 3q09:M, 3q09:N, 3q09:O, 3q09:P, 3q09:Q, 3q09:R, 3q09:S, 3q09:T, 2vxh:A, 2vxh:B, 2vxh:C, 2vxh:D, 2vxh:E, 2vxh:F
3	5a13:B	245	240	0.4167	0.4082	0.4167	5.03e-57	5a12:A, 5a12:B, 5a12:C, 5a12:D, 5a12:E, 5a13:A, 5a13:C, 5a13:D, 5a13:E, 5a13:F, 5a13:G, 5a13:H, 5a13:I, 5a13:J
4	3qpi:A	173	128	0.1625	0.2254	0.3047	3.78e-11	3qpi:B
5	7ati:A	182	89	0.1292	0.1703	0.3483	8.65e-09	7asb:A, 7asb:B, 7ati:B, 5k8z:A, 5k8z:B, 5k8z:C, 5k8z:D, 5k90:A, 5k90:B, 5k90:C, 5k90:D, 5k91:A, 5k91:B, 5k91:C, 5k91:D, 5mau:A, 5mau:B, 5nku:A, 5nku:B, 5nkv:A, 5nkv:B, 7ou5:A, 7ou5:B, 7ou7:A, 7ou7:B, 7ou9:A, 7ou9:B, 7oua:A, 7oua:B, 7ouy:A, 7ouy:B, 7ouy:C, 7ouy:D, 7owi:A, 7owi:B, 7owi:C, 7owi:D, 8quu:A, 8quu:B, 8quv:A, 8quv:B, 8quz:A, 8quz:B, 8qvb:A, 8qvb:B
6	5t2k:B	243	229	0.2375	0.2346	0.2489	1.29e-06	5t2k:A, 5t2k:C, 5t2k:D, 5t2k:E
7	7q4g:C	231	209	0.1958	0.2035	0.2249	0.001	7q4f:A, 7q4f:B, 7q4f:C, 7q4f:D, 7q4f:E, 7q4g:A, 7q4g:B, 7q4g:D, 7q4g:E, 6xub:A, 6xub:B, 6xub:C, 6xub:D, 6xub:E, 6xuc:A, 6xuc:B, 6xuc:C, 6xuc:D, 6xuc:E
8	7pkt:c	318	45	0.0708	0.0535	0.3778	0.63
9	6fxj:A	251	60	0.0750	0.0717	0.3000	1.8	6fxj:B, 6fxj:C, 6fxj:D, 6fxj:E, 6fxq:A, 6fxq:B, 6fxq:C, 6fxq:D, 6fxq:E, 5loq:A, 5loq:B, 5loq:C, 5loq:D, 5loq:E
10	2bov:A	173	51	0.0708	0.0983	0.3333	1.9	2a78:A, 2a9k:A, 8fjh:B, 8fji:B, 6p0i:B, 6p0j:B, 6p0k:B, 6p0l:B, 6p0m:B, 6p0n:B, 6p0o:B, 1u8y:A, 1u8y:B, 1u8z:A, 1u8z:B, 1u90:A, 1u90:B, 1uad:A, 1uad:B, 1zc3:A, 1zc3:C, 1zc4:A, 1zc4:C
11	3k31:A	262	55	0.0792	0.0725	0.3455	2.5
12	4c1n:A	442	64	0.0833	0.0452	0.3125	2.5	4c1n:C, 4c1n:E, 4c1n:G, 2h9a:A, 2ycl:A
13	8wm7:D	257	69	0.0792	0.0739	0.2754	5.4	8w9m:D
14	4s2r:P	615	48	0.0708	0.0276	0.3542	7.2	4s2r:Q, 4s2t:P, 4s2t:Q
15	7q2x:D	994	143	0.1333	0.0322	0.2238	8.4	7q2y:D

[Back]