BioLiP

>protein
ALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML

The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1b4b:A	71	71	1.0000	1.0000	1.0000	4.51e-46	1b4b:C, 1b4b:B
2	2p5m:A	82	71	0.6338	0.5488	0.6338	3.02e-31	2p5m:B, 2p5m:C
3	6wjp:A	80	64	0.3380	0.3000	0.3750	5.31e-13	5jvo:A, 5jvo:B, 6wjo:A, 6wjo:B, 6wjp:B
4	3fhz:D	166	64	0.3521	0.1506	0.3906	2.89e-12	3cag:A, 3cag:C, 3cag:E, 3cag:B, 3cag:D, 3cag:F, 3ere:D, 3fhz:C, 3fhz:E, 3fhz:B, 3fhz:F, 3fhz:A, 3laj:C, 3laj:E, 3laj:B, 3laj:F, 3laj:A, 3laj:D, 3lap:C, 3lap:E, 3lap:B, 3lap:F, 3lap:A, 3lap:D, 2zfz:A, 2zfz:C, 2zfz:F, 2zfz:B, 2zfz:D, 2zfz:E
5	1xxa:C	73	71	0.3662	0.3562	0.3662	5.09e-04	1xxa:A, 1xxa:B, 1xxa:D, 1xxa:F, 1xxa:E, 1xxb:A, 1xxb:C, 1xxb:B, 1xxb:D, 1xxb:E, 1xxb:F
6	5l5a:Y	211	27	0.1690	0.0569	0.4444	2.7	5l5a:K, 5l5b:Y, 5l5b:K, 5l5d:Y, 5l5d:K, 5l5e:Y, 5l5e:K, 5l5f:Y, 5l5f:K, 5l5h:Y, 5l5h:K, 5l5i:Y, 5l5i:K, 5l5j:Y, 5l5j:K, 5l5o:Y, 5l5o:K, 5l5p:Y, 5l5p:K, 5l5q:Y, 5l5q:K, 5l5r:Y, 5l5r:K, 5l5s:Y, 5l5s:K, 5l5t:Y, 5l5t:K, 5l5u:Y, 5l5u:K, 5l5v:Y, 5l5v:K, 5l65:Y, 5l65:K, 5l66:Y, 5l66:K, 5l67:Y, 5l67:K, 5l68:Y, 5l68:K, 5l69:Y, 5l69:K, 5l6a:Y, 5l6a:K, 5l6b:Y, 5l6b:K, 5l6c:Y, 5l6c:K, 5ltt:K, 5ltt:Y, 5m2b:Y, 5m2b:K
7	6bbm:A	405	20	0.1127	0.0198	0.4000	3.3
8	6bbm:D	455	20	0.1127	0.0176	0.4000	3.3	6bbm:F, 6bbm:B, 6bbm:C, 6bbm:E, 6qel:A, 6qel:B, 6qel:C, 6qel:D, 6qel:E, 6qel:F, 6qem:A, 6qem:B, 6qem:C, 6qem:D, 6qem:E, 6qem:F, 7t20:B, 7t20:C, 7t20:E, 7t20:F, 7t20:D, 7t21:A, 7t21:B, 7t21:C, 7t21:D, 7t21:E, 7t21:F, 7t22:A, 7t22:B, 7t22:C, 7t22:D, 7t22:E, 7t22:F, 7t23:A, 7t23:B, 7t23:C, 7t23:D, 7t23:E, 7t23:F
9	7kgb:k	117	31	0.1549	0.0940	0.3548	3.9	6dzi:t, 6dzk:K, 8fr8:m, 7msc:k, 7msh:k, 7msm:k, 7msz:k, 7mt2:k, 7mt3:k, 7mt7:k, 5o5j:K, 5o61:BK, 7sfr:k, 5v93:k, 8v9j:k, 8v9k:k, 8v9l:k, 8whx:l, 8wi7:l, 8wi9:l, 8wib:l, 8wid:l, 8wif:l, 5xyu:K, 5zeb:k, 5zep:k, 5zeu:k
10	2zkt:B	381	22	0.1408	0.0262	0.4545	4.4
11	2zkt:A	330	22	0.1408	0.0303	0.4545	5.5
12	5ubv:A	244	32	0.1690	0.0492	0.3750	6.7	5ubv:B
13	7uhy:A	771	57	0.2254	0.0208	0.2807	7.8	7uhy:B
14	4r81:A	199	45	0.1972	0.0704	0.3111	8.9	4r81:B, 4r81:C, 4r81:D
15	8r42:B	362	32	0.1549	0.0304	0.3438	9.9	8r41:A, 8r41:B, 8r42:A, 8r4x:A, 8r4x:B, 8r4x:C, 8r4x:D

[Back]