BioLiP

>protein
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTF
RPGQKLKSRVENASPK

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2iie:A	204	93	0.9583	0.4510	0.9892	1.22e-62	2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K
2	8flj:G	98	91	0.8021	0.7857	0.8462	2.28e-52	8flj:E
3	4qju:A	90	90	0.3646	0.3889	0.3889	2.32e-19	4qju:B
4	8flj:F	94	90	0.3438	0.3511	0.3667	1.71e-16	8flj:H
5	6o8q:B	91	90	0.3438	0.3626	0.3667	2.93e-15	6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B
6	4dky:B	101	92	0.3750	0.3564	0.3913	7.19e-15
7	1p71:A	94	95	0.3542	0.3617	0.3579	8.57e-15	1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B
8	1ihf:B	94	90	0.3021	0.3085	0.3222	8.47e-13	2ht0:B, 5j0n:J, 5j0n:L, 1ouz:B, 1owf:B, 1owg:B, 5wfe:L
9	2np2:A	102	79	0.2917	0.2745	0.3544	1.22e-11	2np2:B
10	6oaj:B	79	90	0.2708	0.3291	0.2889	6.21e-06	6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A
11	4yew:C	71	56	0.1875	0.2535	0.3214	1.95e-04	6o6k:B, 6oaj:D, 4yex:C, 4yft:C
12	6lmj:A	99	72	0.2188	0.2121	0.2917	0.079	6lmj:B
13	4xwh:A	720	36	0.1354	0.0181	0.3611	0.44
14	4k9q:A	531	46	0.1979	0.0358	0.4130	1.2	4k9q:B
15	5i8s:A	179	42	0.1667	0.0894	0.3810	3.9	5i8t:A, 5i8y:A, 5i91:A, 5i93:A
16	5bu3:A	181	56	0.1458	0.0773	0.2500	7.5	5bu3:B, 5bu3:C, 5bu3:D, 7dvk:A, 7dvk:B, 7dvk:C, 7dvk:D
17	7jxg:A	178	34	0.1354	0.0730	0.3824	8.6	4qgn:A

[Back]