BioLiP

>protein
ALRTRLGEILRPLNAEYGKVVPGWGTTPIMGLTMVLFLVFLLIILQIYNSSLIIENVDVDWANAI

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8iwh:H	65	65	1.0000	1.0000	1.0000	8.02e-42	8iwh:h
2	6j3y:H	66	65	0.8769	0.8636	0.8769	1.39e-37	6j3y:h, 6j3z:H, 6j3z:h, 6j40:H, 6j40:h, 8j5k:H, 8j5k:h, 6jlu:H, 6jlu:h, 7vd5:H, 7vd5:h
3	8wql:HD	64	63	0.7692	0.7812	0.7937	3.46e-31	8wql:HE, 8wql:H1, 8wql:h1, 8wql:hD, 8wql:hE
4	7y5e:HL	66	63	0.8308	0.8182	0.8571	2.51e-28	8wb4:H, 8wb4:h, 8xlp:h, 8xlp:H, 8xr6:H, 8xr6:h, 7y5e:H6, 7y5e:h6, 7y5e:hL, 7y7a:H9, 7y7a:h9, 7y7a:hE, 7y7a:HE, 7y7a:HO, 7y7a:hO, 7y7a:HZ, 7y7a:hZ, 7y7a:Hm, 7y7a:hm
5	7n8o:H	63	63	0.7846	0.8095	0.8095	2.39e-25	7n8o:h, 7rcv:H, 7rcv:h, 8tow:H, 8tow:h, 6wj6:H
6	4yuu:h1	62	61	0.7231	0.7581	0.7705	2.49e-25	4yuu:H1, 4yuu:H2, 4yuu:h2
7	5xnl:H	60	57	0.5538	0.6000	0.6316	5.53e-24	5xnl:h, 5xnm:H, 5xnm:h, 6yp7:h, 6yp7:H
8	8c29:H	62	59	0.5692	0.5968	0.6271	6.15e-24	8c29:h
9	7oui:H	60	58	0.5385	0.5833	0.6034	3.95e-23	3jcu:H, 3jcu:h, 5mdx:H, 5mdx:h, 7oui:h
10	8bd3:H	67	63	0.5538	0.5373	0.5714	7.82e-23	8bd3:h
11	8kde:H	73	61	0.5692	0.5068	0.6066	4.20e-21	6kac:H, 6kac:h, 6kad:H, 6kad:h, 6kaf:H, 6kaf:h, 8r2i:H, 8zee:H
12	7pi0:H	67	60	0.5692	0.5522	0.6167	6.95e-21	7pi0:h, 7pi5:H, 7pi5:h, 7pin:H, 7pin:h, 7pin:H1, 7pin:h1, 7piw:H, 7piw:h, 7piw:H1, 7piw:h1, 7pnk:H, 7pnk:h
13	6dhe:H	65	61	0.6769	0.6769	0.7213	2.21e-19	3a0b:H, 3a0b:h, 3a0h:H, 3a0h:h, 2axt:H, 2axt:h, 5b5e:H, 5b5e:h, 5b66:H, 5b66:h, 7cji:H, 7cji:h, 7cjj:H, 7cjj:h, 7cou:H, 7cou:h, 7czl:H, 7czl:h, 7d1t:H, 7d1t:h, 7d1u:H, 7d1u:h, 6dhe:h, 6dhf:H, 6dhf:h, 6dhg:H, 6dhg:h, 6dhh:H, 6dhh:h, 6dho:H, 6dho:h, 6dhp:H, 6dhp:h, 7dxa:h, 7dxh:h, 5e79:H, 5e79:h, 5e7c:H, 5e7c:h, 7eda:H, 9evx:H, 9evx:h, 8ez5:H, 8ez5:h, 8f4c:H, 8f4c:h, 8f4d:H, 8f4d:h, 8f4e:H, 8f4e:h, 8f4f:H, 8f4f:h, 8f4g:H, 8f4g:h, 8f4h:H, 8f4h:h, 8f4i:H, 8f4i:h, 8f4j:H, 8f4j:h, 8f4k:H, 8f4k:h, 4fby:H, 4fby:W, 8gn0:H, 8gn0:h, 8gn1:H, 8gn1:h, 8gn2:H, 8gn2:h, 5gth:H, 5gth:h, 5gti:H, 5gti:h, 5h2f:H, 5h2f:h, 4il6:H, 4il6:h, 8ir5:H, 8ir5:h, 8ir6:H, 8ir6:h, 8ir7:H, 8ir7:h, 8ir8:H, 8ir8:h, 8ir9:H, 8ir9:h, 8ira:H, 8ira:h, 8irb:H, 8irb:h, 8irc:H, 8irc:h, 8ird:H, 8ird:h, 8ire:H, 8ire:h, 8irf:H, 8irf:h, 8irg:H, 8irg:h, 8irh:H, 8irh:h, 8iri:H, 8iri:h, 4ixq:H, 4ixq:h, 4ixr:H, 4ixr:h, 6jlj:H, 6jlj:h, 6jlk:H, 6jlk:h, 6jll:H, 6jll:h, 6jlm:H, 6jlm:h, 6jln:H, 6jln:h, 6jlo:H, 6jlo:h, 6jlp:H, 6jlp:h, 5kaf:H, 5kaf:h, 5kai:H, 5kai:h, 3kzi:H, 5mx2:H, 5mx2:h, 7nho:H, 7nhp:H, 7nhq:H, 4pbu:H, 4pbu:h, 4pj0:H, 4pj0:h, 7rf1:H, 7rf1:h, 7rf2:H, 7rf2:h, 7rf3:H, 7rf3:h, 7rf4:H, 7rf4:h, 7rf5:H, 7rf5:h, 7rf6:H, 7rf6:h, 7rf7:H, 7rf7:h, 7rf8:H, 7rf8:h, 4rvy:H, 4rvy:h, 1s5l:H, 1s5l:h, 5tis:H, 5tis:h, 4tnh:H, 4tnh:h, 4tni:H, 4tni:h, 4tnj:H, 4tnj:h, 4tnk:H, 4tnk:h, 4ub6:H, 4ub6:h, 4ub8:H, 4ub8:h, 5v2c:H, 5v2c:h, 4v62:AH, 4v62:BH, 4v82:AH, 4v82:BH, 6w1o:H, 6w1o:h, 6w1p:H, 6w1p:h, 6w1q:H, 6w1q:h, 6w1r:H, 6w1r:h, 6w1t:H, 6w1t:h, 6w1u:H, 6w1u:h, 6w1v:H, 6w1v:h, 5ws5:H, 5ws5:h, 5ws6:H, 5ws6:h, 3wu2:H, 3wu2:h, 7yq2:H, 7yq2:h, 7yq7:H, 7yq7:h, 5zzn:H, 5zzn:h
14	8eqm:H	65	50	0.4462	0.4462	0.5800	2.09e-17	8eqm:h
15	7ymi:H	68	62	0.4154	0.3971	0.4355	1.37e-10	7ymi:h, 7ymm:1H, 7ymm:2H, 7ymm:3H, 7ymm:4H
16	6bye:A	861	28	0.1538	0.0116	0.3571	1.9	6bye:B, 6byg:A, 6byg:B, 6byi:A, 6byi:B
17	5fcz:A	499	26	0.1692	0.0220	0.4231	1.9	4c7f:A, 4c7f:B, 4c7g:A, 1hp5:A, 1jak:A, 1m01:A, 1m03:A, 1m04:A
18	3ckq:A	302	34	0.2154	0.0464	0.4118	5.5	3ckn:A, 3cko:A, 3ckv:A
19	4dec:A	284	17	0.1538	0.0352	0.5882	5.8	4de7:A, 3e25:A, 5jsx:A, 5jt0:A, 5juc:A, 5jud:A, 4y6n:A, 4y6u:A, 4y7f:A, 4y7g:A, 4y9x:A

[Back]