ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLE
ANVRVNGETSFKNKW
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2kkh:A | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 1.84e-65 | |
2 | 6a71:B | 71 | 67 | 0.2105 | 0.2817 | 0.2985 | 4.82e-05 | 6a72:A |
3 | 8ioy:A | 816 | 62 | 0.1895 | 0.0221 | 0.2903 | 0.23 | |
4 | 4dy7:F | 378 | 47 | 0.1895 | 0.0476 | 0.3830 | 0.23 | |
5 | 1y3j:A | 77 | 67 | 0.2105 | 0.2597 | 0.2985 | 0.24 | |
6 | 1kvj:A | 79 | 60 | 0.1579 | 0.1899 | 0.2500 | 0.32 | 3cjk:B, 2k1r:A, 5t7l:B |
7 | 8q74:A | 783 | 63 | 0.1368 | 0.0166 | 0.2063 | 0.51 | 8q75:A, 8q76:A |
8 | 7si6:A | 873 | 68 | 0.2105 | 0.0229 | 0.2941 | 0.86 | 7si3:A, 7si7:A |
9 | 1kqk:A | 80 | 73 | 0.2000 | 0.2375 | 0.2603 | 2.1 | |
10 | 6p55:B | 327 | 24 | 0.1158 | 0.0336 | 0.4583 | 2.8 | 6p52:A, 6p53:B, 6p54:A, 6p54:B, 6p55:A, 6xqv:A, 6xqv:B |
11 | 3clh:A | 308 | 30 | 0.1263 | 0.0390 | 0.4000 | 2.8 | 3clh:B |
12 | 1j78:B | 447 | 18 | 0.0947 | 0.0201 | 0.5000 | 4.3 | 1j7e:A, 1j7e:B |
13 | 8g27:I | 720 | 58 | 0.1579 | 0.0208 | 0.2586 | 4.6 | 8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B |
14 | 6xmg:A | 638 | 28 | 0.1263 | 0.0188 | 0.4286 | 4.6 | 6xmf:A |
15 | 8i16:A | 639 | 28 | 0.1263 | 0.0188 | 0.4286 | 4.6 | |
16 | 8i3q:A | 595 | 28 | 0.1263 | 0.0202 | 0.4286 | 4.7 | |
17 | 1s6u:A | 76 | 65 | 0.1789 | 0.2237 | 0.2615 | 5.1 | |
18 | 6e85:A | 331 | 49 | 0.1368 | 0.0393 | 0.2653 | 5.9 | |
19 | 5jp0:A | 745 | 41 | 0.1368 | 0.0174 | 0.3171 | 6.7 | 5jp0:B |
20 | 7plm:A | 1177 | 81 | 0.2526 | 0.0204 | 0.2963 | 8.2 | 7plm:B |
21 | 1b0p:A | 1231 | 81 | 0.2526 | 0.0195 | 0.2963 | 8.2 | 1b0p:B, 2c3m:A, 2c3m:B, 2c3o:A, 2c3o:B, 2c3p:A, 2c3p:B, 2c3u:A, 2c3u:B, 2c3y:A, 2c3y:B, 2c42:A, 2c42:B, 1kek:A, 1kek:B, 2pda:A, 2pda:B, 2uza:A, 2uza:B |