ALMVTREDGSFLIDGTLPIEELREVLGAENNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDKLLLQRLN
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2oai:A | 80 | 79 | 0.9873 | 0.9750 | 0.9873 | 4.37e-52 | 2r8d:A |
2 | 2pls:I | 86 | 83 | 0.4304 | 0.3953 | 0.4096 | 9.14e-20 | 2pls:G, 2pls:H, 2pls:J |
3 | 3ded:C | 91 | 83 | 0.4430 | 0.3846 | 0.4217 | 1.06e-18 | 3ded:A, 3ded:B, 3ded:D, 3ded:E, 3ded:F |
4 | 2p4p:B | 77 | 72 | 0.2658 | 0.2727 | 0.2917 | 1.34e-07 | |
5 | 3lae:A | 81 | 65 | 0.2025 | 0.1975 | 0.2462 | 0.11 | |
6 | 6gxv:A | 481 | 51 | 0.2278 | 0.0374 | 0.3529 | 0.36 | 6gxv:B, 6gya:A, 6gya:B, 6gya:C, 6gya:D |
7 | 1ud2:A | 480 | 44 | 0.2152 | 0.0354 | 0.3864 | 0.79 | 1ud3:A, 1ud4:A, 1ud5:A, 1ud8:A |
8 | 4i58:A | 451 | 27 | 0.1519 | 0.0266 | 0.4444 | 2.0 | 4i58:B, 4i58:C, 4i58:D, 4i59:A, 4i59:B, 4i59:C, 4i59:D |
9 | 2taa:A | 478 | 23 | 0.1139 | 0.0188 | 0.3913 | 2.4 | 2guy:A, 2gvy:A, 2gvy:B, 3kwx:A, 7p4w:A, 2taa:B, 2taa:C, 6taa:A, 7taa:A, 3vx0:A, 3vx1:A, 6xsj:A, 6xsj:B, 6xsv:A, 6yq7:A, 6yq7:B, 6yq9:AAA, 6yq9:BBB, 6yqa:AAA, 6yqa:BBB, 6yqb:AAA, 6yqb:BBB, 6yqc:AAA, 6yqc:BBB |
10 | 5a2a:A | 452 | 28 | 0.1646 | 0.0288 | 0.4643 | 2.9 | 5a2b:A, 5a2c:A |
11 | 6sau:B | 442 | 22 | 0.1139 | 0.0204 | 0.4091 | 3.5 | 6sau:A |
12 | 1v03:A | 487 | 35 | 0.1392 | 0.0226 | 0.3143 | 4.0 | |
13 | 7nsh:BC | 700 | 15 | 0.0886 | 0.0100 | 0.4667 | 4.2 | 7l20:w |
14 | 5kqa:A | 110 | 50 | 0.2025 | 0.1455 | 0.3200 | 6.6 | |
15 | 2die:A | 481 | 25 | 0.1139 | 0.0187 | 0.3600 | 7.5 | |
16 | 8any:A5 | 581 | 30 | 0.1392 | 0.0189 | 0.3667 | 8.2 | |
17 | 3bc9:A | 585 | 20 | 0.1139 | 0.0154 | 0.4500 | 8.2 | 3bcd:A, 3bcf:A |
18 | 7lo5:A | 1016 | 23 | 0.1266 | 0.0098 | 0.4348 | 8.4 | 7lo5:B, 7lo5:C, 7lo5:D, 7lvv:A, 7lvv:B, 7lvv:C, 7lvv:D |
19 | 5t62:W | 306 | 19 | 0.1013 | 0.0261 | 0.4211 | 8.8 | |
20 | 8jjm:A | 484 | 23 | 0.1139 | 0.0186 | 0.3913 | 8.9 | 8jjm:B |
21 | 2y9z:B | 595 | 12 | 0.0633 | 0.0084 | 0.4167 | 9.7 | |
22 | 2gjp:A | 481 | 25 | 0.1266 | 0.0208 | 0.4000 | 9.7 | 2gjr:A, 1w9x:A |
23 | 6qtz:o | 325 | 19 | 0.1013 | 0.0246 | 0.4211 | 9.8 | 6qik:o, 6ri5:o, 6rzz:o, 6s05:o |