BioLiP

>protein
ALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAATGGVKVASVIESQAPEKLVYEPGNPL
ADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLG

The query sequence (length=129) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wk3:V	133	132	1.0000	0.9699	0.9773	3.05e-88	7cg0:h, 7cg0:f, 7cg0:i, 7cg0:j, 7cg0:p, 7cgo:h, 7cgo:f, 7cgo:i, 7cgo:j, 7cgo:p, 7e80:h, 7e80:f, 7e80:i, 7e80:j, 7e80:p, 7e82:h, 7e82:f, 7e82:i, 7e82:j, 7e82:p, 8wk3:W, 8wk3:X, 8wk3:Y, 8wk3:Z, 8wk3:a, 8wkk:V, 8wkk:a, 8wkk:W, 8wkk:X, 8wkk:Y, 8wkk:Z, 8wkq:V, 8wkq:a, 8wkq:W, 8wkq:X, 8wkq:Y, 8wkq:Z, 8wl2:BA, 8wl2:BF, 8wl2:BB, 8wl2:BC, 8wl2:BD, 8wl2:BE, 8wlh:V, 8wlh:a, 8wlh:W, 8wlh:X, 8wlh:Y, 8wlh:Z, 8wln:V, 8wln:a, 8wln:W, 8wln:X, 8wln:Y, 8wln:Z, 8wlq:V, 8wlq:a, 8wlq:W, 8wlq:X, 8wlq:Y, 8wlq:Z, 8wlt:BA, 8wlt:BF, 8wlt:BB, 8wlt:BC, 8wlt:BD, 8wlt:BE, 8wo5:BA, 8wo5:BF, 8wo5:BB, 8wo5:BC, 8wo5:BD, 8wo5:BE, 8woe:BA, 8woe:BF, 8woe:BB, 8woe:BC, 8woe:BD, 8woe:BE
2	8wkk:u	254	44	0.1240	0.0630	0.3636	0.006	8wl2:AI, 8woe:AI
3	1s9i:A	303	55	0.1163	0.0495	0.2727	0.053	1s9i:B
4	8wk3:Q	119	115	0.2403	0.2605	0.2696	0.32	7cg0:k, 7cg0:n, 7cg0:o, 7cgo:k, 7cgo:n, 7cgo:o, 7e80:k, 7e80:n, 7e80:o, 7e82:k, 7e82:n, 7e82:o, 8wk3:R, 8wk3:S, 8wk3:T, 8wkk:Q, 8wkk:R, 8wkk:S, 8wkk:T, 8wlh:Q, 8wlh:R, 8wlh:S, 8wlh:T, 8wlq:Q, 8wlq:R, 8wlq:S, 8wlq:T
5	1f9w:A	300	62	0.1395	0.0600	0.2903	0.41	1f9w:B
6	1zap:A	341	39	0.1163	0.0440	0.3846	0.45	1eag:A, 3pvk:A, 3q70:A
7	8wkq:Q	134	130	0.2713	0.2612	0.2692	0.82	8wkq:R, 8wkq:S, 8wkq:T, 8wkq:U, 8wl2:A6, 8wl2:A7, 8wl2:A8, 8wl2:A9, 8wl2:A0, 8wln:Q, 8wln:R, 8wln:S, 8wln:T, 8wln:U, 8wlt:A6, 8wlt:A7, 8wlt:A8, 8wlt:A9, 8wlt:A0, 8wo5:A6, 8wo5:A7, 8wo5:A8, 8wo5:A9, 8wo5:A0, 8woe:A6, 8woe:A7, 8woe:A8, 8woe:A9, 8woe:A0
8	7btb:m	469	33	0.1163	0.0320	0.4545	1.7	7bt6:m, 6ft6:m, 3jct:m, 6m62:m, 7oh3:m, 7ohq:m, 7oht:m, 7ug6:m, 7uoo:m, 7uqb:m, 7uqz:m, 7uui:m, 7v08:m, 6ylg:m, 6ylh:m
9	6sxu:AAA	500	26	0.0853	0.0220	0.4231	1.8	1pz2:A, 1pz2:B, 1qw8:A, 1qw8:B, 1qw9:A, 1qw9:B, 6sxu:BBB, 6sxv:A, 6sxv:B
10	7cg0:m	106	115	0.2636	0.3208	0.2957	4.1	7cg0:l, 7cgo:m, 7cgo:l, 7e80:m, 7e80:l, 7e82:m, 7e82:l, 8wk3:U, 8wkk:U, 8wlh:U, 8wlq:U
11	4gkr:B	307	59	0.1085	0.0456	0.2373	5.7	4gkr:A
12	8csz:D	494	24	0.0775	0.0202	0.4167	7.3
13	6gej:Y	447	74	0.1473	0.0425	0.2568	8.3	8ets:W, 8ets:U, 8ets:Y, 8etu:W, 8etu:U, 8etu:Y, 8etw:W, 8etw:U, 8etw:Y, 8eu9:W, 8eu9:U, 8eu9:Y, 8euf:W, 8euf:U, 8euf:Y, 6gej:U, 6gej:W, 6gen:U, 6gen:W, 6gen:Y
14	8ctl:D	401	24	0.0775	0.0249	0.4167	8.7	7utn:D, 7xht:A

[Back]