BioLiP

>protein
ALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVA

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ntw:A	61	56	1.0000	0.9180	1.0000	3.88e-33	3ntw:C
2	1jgn:A	98	55	0.5357	0.3061	0.5455	3.36e-15	7bn3:C, 7bn3:A, 7bn3:B, 1jh4:A, 3ktp:A, 3ktr:A, 3kui:A, 3kuj:A, 3kus:A, 3kus:B, 3kut:A, 3kut:B, 3pkn:A, 3pth:A, 2rqg:B, 2rqh:B, 8smo:A, 8smo:C, 8smo:E, 8smo:G, 8smo:I, 8smo:K, 8smo:M, 8smo:O, 2x04:A, 2x04:B
3	6h7b:A	78	56	0.4286	0.3077	0.4286	4.01e-08	6h7b:C
4	6e5v:B	447	40	0.2500	0.0313	0.3500	0.39	6bsz:A, 6bsz:B, 6bt5:A, 6bt5:B, 6e5v:A
5	5vmt:E	293	29	0.2321	0.0444	0.4483	0.48
6	5lqz:A	506	25	0.1964	0.0217	0.4400	0.59	5lqx:A, 5lqx:B, 5lqx:C, 5lqy:A, 5lqy:B, 5lqy:C, 5lqz:B, 5lqz:C
7	7md2:B	458	27	0.1964	0.0240	0.4074	0.66
8	6cp3:C	508	27	0.1964	0.0217	0.4074	0.73	4b2q:A, 4b2q:B, 4b2q:C, 4b2q:a, 4b2q:b, 4b2q:c, 6b8h:K, 6b8h:B, 6b8h:C, 6b8h:n, 6b8h:W, 6b8h:X, 6cp3:A, 6cp3:B, 6cp6:A, 6cp6:B, 6cp6:C, 8f29:A, 8f29:B, 8f29:C, 8f2k:A, 8f2k:B, 8f2k:C, 8f39:A, 8f39:B, 8f39:C, 8fl8:A, 8fl8:B, 8fl8:C, 2hld:A, 2hld:B, 2hld:C, 2hld:J, 2hld:K, 2hld:L, 2hld:S, 2hld:T, 2hld:U, 7md2:A, 7md2:C, 7md3:A, 7md3:B, 7md3:C, 3oe7:A, 3oe7:B, 3oe7:C, 3oe7:J, 3oe7:K, 3oe7:L, 3oe7:S, 3oe7:T, 3oe7:U, 3oee:A, 3oee:B, 3oee:C, 3oee:J, 3oee:K, 3oee:L, 3oee:S, 3oee:T, 3oee:U, 3oeh:A, 3oeh:B, 3oeh:C, 3oeh:J, 3oeh:K, 3oeh:L, 3oeh:S, 3oeh:T, 3oeh:U, 3ofn:A, 3ofn:B, 3ofn:C, 3ofn:J, 3ofn:K, 3ofn:L, 3ofn:S, 3ofn:T, 3ofn:U, 7tjs:A, 7tjs:B, 7tjs:C, 7tjt:A, 7tjt:B, 7tjt:C, 7tju:A, 7tju:B, 7tju:C, 7tjv:A, 7tjv:B, 7tjv:C, 7tjw:A, 7tjw:B, 7tjw:C, 7tjx:A, 7tjx:B, 7tjx:C, 2wpd:A, 2wpd:B, 2wpd:C, 2xok:A, 2xok:B, 2xok:C, 3zia:A, 3zia:B, 3zia:C, 3zia:K, 3zia:L, 3zia:M, 3zry:A, 3zry:B, 3zry:C
9	8jd6:R	774	31	0.2321	0.0168	0.4194	0.93	7e9h:R, 7e9h:S, 8jd4:4, 8jd5:4, 8jd6:S
10	7rtm:A	571	38	0.2321	0.0228	0.3421	1.6	7rtm:B
11	7w02:A	1566	24	0.2143	0.0077	0.5000	5.3
12	8sfo:A	1240	19	0.1250	0.0056	0.3684	5.8	8sfi:A, 8sfp:A, 8sfq:A, 8sfr:A
13	3hm8:A	441	30	0.1786	0.0227	0.3333	6.2	3hm8:B, 3hm8:C, 3hm8:D
14	8sfn:A	1302	19	0.1250	0.0054	0.3684	6.2	8sfh:A, 8sfl:A, 5xh6:A, 5xh7:A
15	5kk5:A	1201	19	0.1250	0.0058	0.3684	6.2
16	5b43:A	1272	19	0.1250	0.0055	0.3684	6.4
17	5lzw:ii	372	38	0.1964	0.0296	0.2895	8.6	5lzx:ii, 5lzy:ii, 5lzz:ii

[Back]