ALFTSLVGASGLGFATKFLSNKIRLKPAGYYPLGYVFSGVAWAGLGLVLHNVHQHSLEVLEKKK
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7zkq:b | 66 | 64 | 1.0000 | 0.9697 | 1.0000 | 4.24e-41 | 7o6y:b, 7o71:b, 6rfq:b, 6rfr:b, 6y79:b, 7zkp:b |
2 | 5iku:A | 240 | 21 | 0.1719 | 0.0458 | 0.5238 | 0.090 | 4hpk:A, 4hpk:B, 1nqd:A, 1nqd:B, 2o8o:A, 2o8o:B |
3 | 7c4c:A | 332 | 42 | 0.2031 | 0.0392 | 0.3095 | 8.8 | 7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A |