ALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAA
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wim:A | 94 | 69 | 0.9067 | 0.7234 | 0.9855 | 5.73e-45 | 6l99:A |
2 | 8eb0:A | 255 | 54 | 0.2267 | 0.0667 | 0.3148 | 0.001 | 7m4m:A, 7m4m:B, 7m4n:A, 7m4n:B, 7m4o:A |
3 | 7od1:A | 430 | 56 | 0.2400 | 0.0419 | 0.3214 | 0.002 | 7od1:B |
4 | 7oni:H | 380 | 56 | 0.2400 | 0.0474 | 0.3214 | 0.002 | |
5 | 6l8n:A | 810 | 58 | 0.2133 | 0.0198 | 0.2759 | 0.005 | |
6 | 4kbl:A | 395 | 58 | 0.2400 | 0.0456 | 0.3103 | 0.005 | 4kbl:B, 5udh:B |
7 | 6sc6:A | 365 | 52 | 0.2000 | 0.0411 | 0.2885 | 0.008 | 5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C |
8 | 6sc6:A | 365 | 64 | 0.2800 | 0.0575 | 0.3281 | 4.8 | 5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C |
9 | 7b5l:H | 423 | 55 | 0.2267 | 0.0402 | 0.3091 | 0.012 | 7b5n:H, 4kc9:A, 5udh:A |
10 | 5tte:B | 442 | 52 | 0.2267 | 0.0385 | 0.3269 | 0.016 | 7b5m:H, 2m9y:A, 1wd2:A |
11 | 4crm:P | 608 | 29 | 0.1333 | 0.0164 | 0.3448 | 0.57 | 7a1g:x, 8cah:x, 3j16:B |
12 | 8cas:k | 579 | 29 | 0.1333 | 0.0173 | 0.3448 | 0.62 | 5ll6:h, 6zce:k, 6zu9:k |
13 | 4s3o:C | 95 | 39 | 0.1733 | 0.1368 | 0.3333 | 0.90 | 4s3o:F |
14 | 6wi7:A | 206 | 39 | 0.2133 | 0.0777 | 0.4103 | 1.3 | 2ckl:A, 8grm:M, 2h0d:A, 7nd1:H, 8pp7:K, 8pp7:M, 4r8p:K, 4r8p:M, 3rpg:B, 6wi8:A, 6wi8:B |
15 | 2y43:A | 88 | 40 | 0.1333 | 0.1136 | 0.2500 | 1.6 | 2y43:B |
16 | 1rp1:A | 441 | 11 | 0.0933 | 0.0159 | 0.6364 | 2.6 | |
17 | 2ppl:A | 449 | 11 | 0.0933 | 0.0156 | 0.6364 | 2.8 | |
18 | 8w5z:A | 333 | 33 | 0.1600 | 0.0360 | 0.3636 | 3.2 | 8w5z:C |
19 | 5h1y:B | 245 | 21 | 0.1600 | 0.0490 | 0.5714 | 5.8 | 5h1y:A |
20 | 1gpl:A | 432 | 14 | 0.0933 | 0.0162 | 0.5000 | 7.4 | |
21 | 1w52:X | 448 | 11 | 0.0933 | 0.0156 | 0.6364 | 8.2 |