BioLiP

>protein
ALDAAYCFRNVQDNCCLRPLYIDFRKDLGWKWIHEPKGYNANFCAGACPKSPSCVSQDLEPLTIVYYVGRKPKVEQLSNM
IVKSCKCS

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5tx6:A	88	88	1.0000	1.0000	1.0000	5.42e-63
2	6y6n:A	116	107	0.3636	0.2759	0.2991	1.48e-09	6y6o:A
3	6omn:G	108	107	0.3409	0.2778	0.2804	1.55e-06	6omn:E, 6omn:H
4	8bwl:A	105	102	0.3295	0.2762	0.2843	0.002	8bwl:B, 8bwm:A, 8bwm:B, 8bwn:A, 8bwn:B
5	4yci:C	105	36	0.1705	0.1429	0.4167	0.40
6	1h46:X	431	44	0.1250	0.0255	0.2500	0.84	1z3t:A, 1z3v:A, 1z3w:A
7	3pfx:A	436	33	0.1023	0.0206	0.2727	3.7	3pfz:A, 3pl3:A
8	2ceq:A	489	22	0.0795	0.0143	0.3182	6.2	2ceq:B, 2cer:A, 2cer:B, 4ean:A, 4ean:B, 5ixe:A, 5ixe:B, 1uwr:A, 1uwr:B, 1uws:B, 1uws:A, 1uwt:A, 1uwt:B, 1uwu:A, 1uwu:B, 7uz1:A, 7uz1:B, 7uz2:A, 7uz2:B
9	6ltp:G	923	27	0.1023	0.0098	0.3333	6.4	6ltp:A
10	2b51:A	444	22	0.1023	0.0203	0.4091	7.2	2b56:A
11	5chc:A	895	20	0.0909	0.0089	0.4000	7.6	5ch7:A, 5ch7:C, 5ch7:E, 5chc:C, 5chc:E, 5e7o:A, 5e7o:C, 5e7o:E, 5e7o:G, 5e7o:I, 5e7o:K, 4ydd:A, 4ydd:C, 4ydd:E
12	8p5d:LC0	327	62	0.1818	0.0489	0.2581	8.3	8p60:LC0, 8p60:KC0, 7qca:LC0
13	6lu0:A	937	27	0.1023	0.0096	0.3333	9.1
14	6ltr:A	1037	27	0.1023	0.0087	0.3333	9.1	6ltu:A
15	6e60:A	538	36	0.1136	0.0186	0.2778	9.8	6dmf:A, 6dmf:B, 6dmf:C, 6dmf:D, 6dmf:E, 6dmf:F, 6dmf:G, 6dmf:H, 6dmf:I, 6dmf:J, 6e61:A, 6e61:B, 7nox:A, 7nox:B

[Back]