Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
ALCCLWSDWINEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLSQKVQCDVSVGFICKNEDQFGNGPFGLC
YDYKIRVNCCWPMDC

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7a5o:A 1205 90 0.9263 0.0730 0.9778 1.10e-56 7a5o:B, 7a5o:C, 7a5o:D, 7a5o:E, 7a5o:F, 7a5o:G, 7a5o:H, 7a5o:I, 7a5o:J, 8ck2:A, 7pov:A, 7pov:B, 7pov:C, 7pov:D, 7pp6:A, 7pp6:B, 7pp6:C, 7pp6:D, 7pp6:E, 7pp6:G, 7prl:A, 6rbf:A, 6rbf:B, 6rbf:C, 6rbf:D, 6tm2:A, 6tm2:B, 6tm2:C, 6tm2:D, 6tm2:E, 6tm2:F, 6tm6:A
2 8ov0:A 110 97 0.4105 0.3545 0.4021 8.33e-21
3 8s03:A 100 91 0.4105 0.3900 0.4286 1.08e-18
4 8oer:I 100 99 0.4211 0.4000 0.4040 4.00e-17 8oer:J, 8oes:I, 8oes:J, 8oes:K, 8oes:L, 8oes:M, 8oes:N
5 4oal:A 444 26 0.1263 0.0270 0.4615 3.5 4oal:B
6 8i23:D 1154 39 0.1368 0.0113 0.3333 5.6 8i24:D
7 8esq:m 572 21 0.1263 0.0210 0.5714 7.3 8esr:m, 8etg:m, 8eti:m, 8eug:m, 8eui:m
8 8wm6:g 219 40 0.1579 0.0685 0.3750 9.4 8wmv:g, 8wmw:g

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218