ALALDTPLPTPSGWTTMGDVAVGDHLLGPDGEPTRVVADTDVMLGRPCYVVEFSDGTAIVADAQHQWPTEHGVRITANLR
AGMHTVVAVQITAVRRRPSVPVRCVEVDNPEHLYLAGPGMVPTHN
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6own:B | 129 | 129 | 1.0000 | 0.9690 | 0.9690 | 1.89e-86 | 6own:A, 6own:C |
2 | 8bir:A | 321 | 50 | 0.1040 | 0.0405 | 0.2600 | 0.13 | 8big:A, 8big:B, 8big:C, 8big:D, 8big:E, 8big:F, 8big:G, 8big:H, 8bii:A, 8bii:B, 8bii:C, 8bii:D, 8bii:E, 8bii:F, 8bii:G, 8bii:H, 8bir:B |
3 | 8r6s:E | 1091 | 32 | 0.0960 | 0.0110 | 0.3750 | 0.56 | 8rdj:E |
4 | 8bie:A | 318 | 63 | 0.1200 | 0.0472 | 0.2381 | 0.95 | 8bie:B, 8bij:A, 8bij:B |
5 | 2o7p:A | 358 | 56 | 0.1360 | 0.0475 | 0.3036 | 2.3 | 2o7p:B, 2obc:A |
6 | 8wa1:c | 1176 | 31 | 0.0800 | 0.0085 | 0.3226 | 3.8 | |
7 | 8bif:A | 318 | 44 | 0.0720 | 0.0283 | 0.2045 | 4.0 | 8bif:B, 8bif:C, 8bif:D |
8 | 6hqv:A | 1555 | 89 | 0.1920 | 0.0154 | 0.2697 | 5.9 | 6hqv:B |
9 | 3acl:A | 288 | 38 | 0.0960 | 0.0417 | 0.3158 | 7.3 | 4ero:A, 4ewa:A, 4ewd:A, 4ewe:A, 4gul:A, 6h1h:A, 6h1i:A, 4hlt:A, 1j1l:A, 5jct:A, 6n0j:A, 6n0k:A |
10 | 5jcp:A | 361 | 45 | 0.1040 | 0.0360 | 0.2889 | 7.6 | 5jcp:B |