AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ha4:A | 55 | 55 | 1.0000 | 1.0000 | 1.0000 | 2.58e-32 | 6hah:A, 6haj:A, 6haj:B |
2 | 7bad:A | 58 | 55 | 0.3455 | 0.3276 | 0.3455 | 2.85e-05 | |
3 | 1lba:A | 146 | 46 | 0.2545 | 0.0959 | 0.3043 | 1.2 | |
4 | 6nf0:A | 298 | 20 | 0.1636 | 0.0302 | 0.4500 | 3.7 | 6bt2:A |
5 | 6co7:A | 1061 | 33 | 0.1818 | 0.0094 | 0.3030 | 8.2 | 6co7:B, 6co7:C, 6co7:D |