BioLiP

>protein
AKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASL
AKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELL
DLIPFFEGLSRE

The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2hhl:C	184	172	1.0000	0.9348	1.0000	1.29e-126	2hhl:A, 2hhl:D
2	1t9z:A	181	170	0.8140	0.7735	0.8235	5.88e-107	6du2:A, 6du2:B, 6du3:A, 6du3:B, 2ghq:A, 2ghq:B, 2ght:A, 2ght:B, 3l0b:A, 3l0c:A, 3l0c:B, 3l0y:A, 3l0y:B, 3pgl:A, 3pgl:B, 1ta0:A, 4ygy:A, 4ygy:B, 4yh1:A, 4yh1:B
3	2q5e:A	181	167	0.8256	0.7845	0.8503	1.06e-103	2q5e:B, 2q5e:C, 2q5e:D, 2q5e:E, 2q5e:F, 2q5e:G, 2q5e:H
4	8ujm:B	237	157	0.4186	0.3038	0.4586	1.79e-43	8ujm:A
5	4qqf:F	191	157	0.3547	0.3194	0.3885	1.38e-29	3qle:A
6	3ef1:A	372	104	0.1512	0.0699	0.2500	4.13e-05	3ef0:A, 4xpz:A, 4xq0:A
7	3shq:A	299	191	0.2674	0.1538	0.2408	0.038
8	6yjb:A	309	94	0.1395	0.0777	0.2553	0.15	6ykf:A, 6ymg:A, 6ymg:B
9	2y3a:A	976	47	0.0930	0.0164	0.3404	3.0
10	3o8o:E	752	24	0.0640	0.0146	0.4583	3.7	3o8o:A, 3o8o:C, 3o8o:G
11	7dhw:A	726	63	0.1395	0.0331	0.3810	5.2
12	2zu8:A	373	160	0.2209	0.1019	0.2375	8.5	2zu8:B, 2zu9:B, 2zu9:A

[Back]