AKTQAEINKRLDAYAKGTVDSPYRVKKATSYDPSFGVMEAGAIDADGYYHAQQDLITDYVLWLTDNKVRTWGNAKDQIKQ
SYGTGFKIHENKPSTVPKKGWIAVFTSGSYEQWGHIGIVYDGGNTSTFTILEQNWNGYANKKPTKRVDNYYGLTHFIEIP
VKA
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4olk:B | 165 | 164 | 0.9877 | 0.9758 | 0.9817 | 3.49e-118 | 4csh:A, 4csh:B, 4csh:C, 4csh:D, 4ct3:A, 4ct3:B, 4ct3:C, 4ct3:D, 4olk:A |
2 | 8h1i:A | 250 | 129 | 0.3374 | 0.2200 | 0.4264 | 1.06e-19 | |
3 | 6ist:C | 213 | 100 | 0.2025 | 0.1549 | 0.3300 | 6.32e-07 | |
4 | 2a2g:A | 158 | 72 | 0.1227 | 0.1266 | 0.2778 | 0.55 | 2a2g:B, 2a2g:C, 2a2g:D |
5 | 5fbt:A | 769 | 44 | 0.0920 | 0.0195 | 0.3409 | 1.2 | |
6 | 1e5d:A | 401 | 35 | 0.0736 | 0.0299 | 0.3429 | 1.4 | 1e5d:B |
7 | 6li9:A | 623 | 105 | 0.1656 | 0.0433 | 0.2571 | 8.1 | 6li9:C, 6lid:A, 6lid:C, 6yup:A, 6yup:C, 6yuz:A, 6yuz:C |