AKRFRYNTKYPSLVSYNKLPWEILNHETPEFHMHVAPHYEQIMTLAASTHVPHIVGKKHLEMPPEHRLRLLPGMFYMLDG
DSIPEGFTANRVLDPTALQYYGRLESLVAPVQAVRMLISDDLRIVCNSVTLQGPLQLPVASYASLASLEVVTNKASASFT
LFHFVRPNRPPSELQLEKYYIHAPRAMALAEFNSTSNTSWEPKLQAPKRSKRVTPLPAYRPPQSYLMGLAERLAVVPGSS
FGRRSLMWGHWF
The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aor:as | 252 | 252 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6sga:DR | 254 | 254 | 0.7302 | 0.7244 | 0.7244 | 2.21e-142 | 6hiv:DR, 6hiw:DR, 6hiy:DR, 7pua:DR, 7pub:DR, 6sgb:DR |
3 | 4w6q:B | 332 | 118 | 0.1151 | 0.0873 | 0.2458 | 0.13 | 4w6q:A, 4w6q:C, 4w6q:D |
4 | 2k6z:A | 120 | 108 | 0.1190 | 0.2500 | 0.2778 | 1.2 | 2k70:A |
5 | 7v0h:G | 253 | 43 | 0.0595 | 0.0593 | 0.3488 | 4.0 | 7v0h:A, 7v0h:B, 7v0h:C, 7v0h:D, 7v0h:E, 7v0h:F, 7v0h:H |