AKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDVGYHFIIKRDGTVEAGRDEMAVGSHAKGYNHNSIGVCLVGG
IDDKGKFDANFTPAQMQSLRSLLVTLLAKYEGAVLRAHHEVAPKACPSFDLKRWWEKNELVTSDRG
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1lba:A | 146 | 146 | 1.0000 | 1.0000 | 1.0000 | 1.60e-109 | |
2 | 6srt:A | 152 | 108 | 0.2945 | 0.2829 | 0.3981 | 1.02e-20 | 6ssc:A |
3 | 4z8i:A | 224 | 124 | 0.2808 | 0.1830 | 0.3306 | 3.70e-13 | |
4 | 7f5i:A | 153 | 135 | 0.2671 | 0.2549 | 0.2889 | 6.15e-13 | |
5 | 1oht:A | 173 | 120 | 0.2466 | 0.2081 | 0.3000 | 1.49e-10 | 7nsx:AAA, 7nsz:AAA, 7nt0:AAA, 7nt0:BBB |
6 | 2cb3:C | 173 | 67 | 0.1712 | 0.1445 | 0.3731 | 1.96e-08 | 2cb3:A, 2cb3:B, 2cb3:D |
7 | 2f2l:X | 166 | 104 | 0.2123 | 0.1867 | 0.2981 | 2.75e-08 | |
8 | 6fhg:A | 156 | 125 | 0.2671 | 0.2500 | 0.3120 | 3.61e-08 | 6fhg:B |
9 | 2xz4:A | 165 | 142 | 0.2534 | 0.2242 | 0.2606 | 7.56e-08 | |
10 | 2aph:A | 165 | 83 | 0.1849 | 0.1636 | 0.3253 | 8.46e-08 | 2aph:B, 1sk4:A, 1twq:A |
11 | 3cg9:A | 171 | 120 | 0.2603 | 0.2222 | 0.3167 | 4.01e-07 | 6a89:B, 6a89:A, 6a89:D, 3cg9:B, 3cxa:A, 3cxa:B, 7dy5:C, 5e0b:C, 4fnn:A, 4fnn:B, 4fnn:D, 4gf9:D, 4gf9:C, 3ng4:C, 3ng4:D, 3nno:D, 3nw3:D, 3o4k:A, 3o4k:C, 3o4k:D, 3ogx:C, 3ogx:A, 4opp:A, 4opp:B, 4opp:D, 4opp:C, 4orv:D, 4oug:C, 4oug:D, 4q8s:A, 4q8s:C, 4q8s:D, 4q9e:D, 3qv4:C, 3rt4:C, 3rt4:D, 3t2v:B, 3t2v:D, 3t39:D, 3tru:D, 3usx:B, 7xfw:C, 7xfx:C, 7xfy:C, 7xfy:D, 7xu8:A, 7xu8:B |
12 | 6su5:A | 154 | 101 | 0.1986 | 0.1883 | 0.2871 | 2.47e-06 | |
13 | 2eax:C | 164 | 56 | 0.1096 | 0.0976 | 0.2857 | 0.009 | |
14 | 2f2l:A | 167 | 34 | 0.0890 | 0.0778 | 0.3824 | 0.063 | |
15 | 3d2y:A | 257 | 67 | 0.1575 | 0.0895 | 0.3433 | 0.33 | 2bh7:A, 3d2z:A, 2wkx:A |
16 | 6ttb:A | 331 | 64 | 0.1301 | 0.0574 | 0.2969 | 1.2 | |
17 | 6ei3:A | 511 | 30 | 0.0959 | 0.0274 | 0.4667 | 2.2 | |
18 | 4uvm:A | 505 | 25 | 0.0890 | 0.0257 | 0.5200 | 3.9 | |
19 | 5ave:A | 252 | 33 | 0.0822 | 0.0476 | 0.3636 | 6.4 | 5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B |
20 | 4ipi:A | 351 | 35 | 0.0753 | 0.0313 | 0.3143 | 6.8 | 4ipj:A, 6ppw:A, 6ppy:A, 6ppz:A, 2wqp:A, 1xuu:A, 1xuz:A |