BioLiP

>protein
AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVTSLLEKYKIDPKQIGRLEVG
SETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGG
AAAIAMLIGPDAPIVFESKLRGSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDA
DYFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVSQQLAKTYYDAKVQPTTLVP
KQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMFSYGAGSTATMFSLRLCENQSPFSLSNIASVMDVGGKLKARHEYAPE
KFVETMKLMEHRYGAKEFVTSKEGILDLLAPGTYYLKEVDSLYRRFYGKK

The query sequence (length=450) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7cqt:A	450	450	1.0000	1.0000	1.0000	0.0	7cqt:B, 7cqt:C, 2fa0:A, 2fa3:A
2	2f9a:A	404	450	0.8956	0.9975	0.8956	0.0
3	2p8u:A	462	456	0.5044	0.4913	0.4978	2.05e-158	2p8u:B
4	2wya:A	460	457	0.4756	0.4652	0.4683	3.85e-153	2wya:B, 2wya:C, 2wya:D
5	5hwo:A	418	460	0.3089	0.3325	0.3022	2.02e-49	5hwp:A, 5hwq:A, 5hwr:A
6	3v4x:A	387	368	0.2289	0.2661	0.2799	5.86e-35	3v4x:B, 3v4x:C, 3v4x:D, 1ysl:B
7	1xpl:A	389	375	0.2356	0.2725	0.2827	5.11e-26	1txt:A, 1txt:B, 1txt:C, 1txt:D, 1xpk:A, 1xpk:B, 1xpk:C, 1xpk:D, 1xpl:B, 1xpl:C, 1xpl:D, 1xpm:A, 1xpm:B, 1xpm:C, 1xpm:D
8	5kp7:A	410	323	0.1911	0.2098	0.2663	1.30e-24	5kp8:A
9	3sqz:A	388	423	0.2511	0.2912	0.2671	2.99e-22
10	6esq:I	347	269	0.1578	0.2046	0.2639	6.13e-10
11	8d1u:A	318	136	0.0800	0.1132	0.2647	1.1	5bnm:A, 5bnr:A, 5bns:A, 5bns:B, 1ebl:A, 1ebl:B, 2eft:A, 2eft:B, 2gyo:A, 1hnd:A, 1hnh:A, 1hnj:A, 1mzs:A, 6x7r:A, 4z8d:A, 4z8d:B
12	6hh9:B	370	185	0.0933	0.1135	0.2270	4.4	6hh9:A, 6hh9:C, 6hh9:D
13	7myv:B	239	47	0.0333	0.0628	0.3191	7.9	7myv:A

[Back]