AKKIFTSALGTAEPYAYIAKPDYPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPPYEGDMPFFDNG
DGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVEL
ATFGGGEDDWADEVEENGYVAS
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1je5:B | 182 | 182 | 1.0000 | 1.0000 | 1.0000 | 5.94e-135 | |
| 2 | 2yzv:A | 286 | 45 | 0.0934 | 0.0594 | 0.3778 | 5.5 | |
| 3 | 3ulp:C | 116 | 77 | 0.1209 | 0.1897 | 0.2857 | 5.7 | 3ulp:A, 3ulp:B, 3ulp:D |
| 4 | 8iuf:5B | 157 | 56 | 0.0769 | 0.0892 | 0.2500 | 6.3 | 8iuj:5B, 8iuj:5b |
umich.edu