AKIPFYIMEEHNEAFFIWHYAVAEGWINKNQNTLLHVDEHSDLVVPILNSSLKSVNENIKRVHDFTYSELTIANFIYPAL
YQGVFSQVYWLRQKHDPKLNGQKQLNIYSHQGEGKRLILKSKVDFNNLFNPDCKSFTITPLNAQDDLSSEESKKLNKSVI
LDIDIDYFSCDNVSGEYLEVEITEEAYYDYINNLYNKLRICWGGNASVKYMDGKYYFCIIQPDKLVAENLKVSEDAIVER
IDALIDFLKVNEIQPKLIDVCRSRLSGYTPNDQWEFIENTLVEKLSSIYEFEPIFVSELSKKVLV
The query sequence (length=305) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8brp:A | 305 | 305 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8brp:B, 8brp:C, 8brp:D |
2 | 8bzx:A | 546 | 125 | 0.1180 | 0.0659 | 0.2880 | 1.0 | |
3 | 8agc:E | 438 | 47 | 0.0557 | 0.0388 | 0.3617 | 2.1 | 8agb:E, 8age:E, 6c26:1, 6ezn:A |
4 | 7z0s:G | 250 | 61 | 0.0590 | 0.0720 | 0.2951 | 4.0 | 7z0t:G |
5 | 1u8c:B | 599 | 118 | 0.0984 | 0.0501 | 0.2542 | 7.9 | 1jv2:B, 1l5g:B, 1m1x:B |