BioLiP

>protein
AKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAMLEAQ
QEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDITKV

The query sequence (length=135) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a5f:A	162	135	0.9926	0.8272	0.9926	9.14e-92	7a5g:A, 7a5h:8, 7a5i:83, 7a5j:8, 7a5k:A, 8any:8, 6i9r:8, 3j7y:8, 3j9m:8, 8k2a:Ln, 8k2b:Ln, 7l08:8, 7l20:8, 6nu2:8, 6nu3:8, 7o9k:8, 7o9m:8, 7odr:8, 7ods:8, 7odt:8, 7of0:8, 7of2:8, 7of3:8, 7of4:8, 7of5:8, 7of6:8, 7of7:8, 7og4:8, 7oi7:8, 7oi8:8, 7oi9:8, 7oia:8, 7oib:8, 7oic:8, 7oid:8, 7oie:8, 8oir:Bp, 8oit:Bp, 5ool:8, 5oom:8, 7pd3:8, 8pk0:8, 7po4:8, 7qi4:8, 7qi5:8, 7qi6:8, 8qsj:8, 8qu5:8, 6vlz:8, 6vmi:8, 8xt0:Ln, 8xt1:Ln, 8xt2:Ln, 8xt3:Ln, 6zm5:8, 6zm6:8, 6zs9:8, 6zsa:8, 6zsb:8, 6zsc:8, 6zsd:8, 6zse:8, 6zsg:8
2	8oin:Bp	143	135	0.7556	0.7133	0.7556	3.20e-72	5aj4:Bd, 6gaw:Bd, 6gb2:Bd, 7nqh:Bd, 7nql:Bd, 7nsh:Bd, 7nsi:Bd, 7nsj:Bd, 8oiq:Bp, 6ydp:Bd, 6ydw:Bd
3	3j6b:2	113	95	0.1852	0.2212	0.2632	0.055	5mrc:2, 5mre:2, 5mrf:2
4	1eu4:A	204	70	0.1185	0.0784	0.2286	0.076
5	4aos:A	523	79	0.1778	0.0459	0.3038	0.33	4aox:A, 4ap1:A, 4ap3:A
6	4obi:A	87	26	0.0815	0.1264	0.4231	1.4
7	7ed6:A	203	77	0.1852	0.1232	0.3247	5.5	7ed6:B, 7ed9:A, 7ed9:B
8	6xyw:AF	84	84	0.1926	0.3095	0.3095	7.7

[Back]