AKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALI
The query sequence (length=136) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3sfe:C |
139 |
136 |
0.9044 |
0.8849 |
0.9044 |
1.29e-89 |
3abv:C, 3ae1:C, 3ae2:C, 3ae3:C, 3ae4:C, 3ae5:C, 3ae6:C, 3ae7:C, 3ae8:C, 3ae9:C, 3aea:C, 3aeb:C, 3aec:C, 3aed:C, 3aee:C, 3aef:C, 3aeg:C, 8gs8:C, 3sfd:C, 4ytp:C, 4yxd:C, 1zoy:C, 1zp0:C |
2 |
2wqy:C |
140 |
136 |
0.7279 |
0.7071 |
0.7279 |
2.29e-71 |
2fbw:C, 2fbw:P, 2h88:C, 2h88:P, 2h89:C, 6myo:C, 6myp:C, 6myq:C, 6myr:C, 6mys:C, 6myt:C, 6myu:C, 2wqy:P, 1yq3:C, 1yq4:C |
3 |
4ysx:G |
155 |
118 |
0.3015 |
0.2645 |
0.3475 |
7.77e-22 |
5c2t:C, 5c2t:G, 5c3j:C, 5c3j:G, 3vr8:C, 3vr8:G, 3vr9:C, 3vr9:G, 3vra:C, 3vra:G, 3vrb:C, 3vrb:G, 4ysx:C, 4ysy:C, 4ysy:G, 4ysz:C, 4ysz:G, 4yt0:C, 4yt0:G, 4ytm:C, 4ytm:G, 4ytn:C, 4ytn:G |
4 |
2acz:C |
129 |
100 |
0.1912 |
0.2016 |
0.2600 |
2.58e-04 |
7jz2:C, 7jz2:G, 7jz2:K, 1nek:C, 1nen:C, 2wdq:C, 2wdq:G, 2wdq:K, 2wdr:C, 2wdr:G, 2wdr:K, 2wdv:C, 2wdv:G, 2wdv:K, 2wp9:C, 2wp9:G, 2wp9:K, 2ws3:C, 2ws3:G, 2ws3:K, 2wu2:C, 2wu2:G, 2wu2:K, 2wu5:C, 2wu5:G, 2wu5:K, 6wu6:C, 6wu6:G, 6wu6:K |
5 |
2jal:B |
444 |
31 |
0.0809 |
0.0248 |
0.3548 |
0.65 |
2cbu:A, 2cbu:B, 2cbv:A, 2cbv:B, 2ces:A, 2ces:B, 2cet:A, 2cet:B, 2j75:A, 2j75:B, 2j77:A, 2j77:B, 2j78:A, 2j78:B, 2j79:A, 2j79:B, 2j7b:A, 2j7b:B, 2j7c:A, 2j7c:B, 2j7d:A, 2j7d:B, 2j7e:A, 2j7e:B, 2j7f:A, 2j7f:B, 2j7g:A, 2j7g:B, 2j7h:A, 2j7h:B, 2jal:A, 5n6s:A, 5n6s:B, 5n6s:C, 5n6s:D, 5n6t:A, 5n6t:B, 1oif:A, 1oif:B, 1oim:A, 1oim:B, 1oin:A, 1oin:B, 5oss:B, 1uz1:A, 1uz1:B, 2vrj:A, 2vrj:B, 1w3j:A, 1w3j:B, 2wbg:A, 2wbg:B, 2wbg:C, 2wbg:D, 2wc3:A, 2wc3:B, 2wc3:C, 2wc3:D, 2wc4:A, 2wc4:B, 2wc4:C, 2wc4:D |
6 |
3go9:A |
458 |
33 |
0.0956 |
0.0284 |
0.3939 |
0.75 |
|
7 |
6nmx:A |
350 |
24 |
0.0588 |
0.0229 |
0.3333 |
2.2 |
6cgq:A, 6cgq:B, 6nmx:B, 6nmx:C, 6nmx:D |
8 |
3gnr:A |
478 |
22 |
0.0588 |
0.0167 |
0.3636 |
2.8 |
3wba:A, 3wbe:A |
9 |
5tu0:A |
385 |
57 |
0.1250 |
0.0442 |
0.2982 |
3.5 |
|
10 |
5van:A |
861 |
18 |
0.0588 |
0.0093 |
0.4444 |
8.5 |
6nfj:A, 6nfj:D, 5vaq:A |
11 |
3wq5:A |
475 |
29 |
0.0809 |
0.0232 |
0.3793 |
8.9 |
3wq5:B, 3wq6:A, 3wq6:B |