AKEDTWAFGPIGSPFPDNPVKALGQQNMYVALWYKNGRPMHGRAWNNGGVIECSFPYNKSELTGVKDLGGQIQVLQYKGN
HLSLGYWYNWIKYSDRFDKMDKGAEMLRCGDSFPILWSERPGGALLGYADNKTEIARFSHDGKVDEVSGSALANMLIIAR
ELKGGPPYCECEECKSEPPKVRVTLNEWADFRCGDPWPTVGTPVRALGRSLDTLPGENPDQYVALWYQSGEPVMGRIWND
GGKIAACFGWGGHEYRQKIGSIQILYELPEAIRGFDYDWKPFPEAAQEWIPVHVDHHKGNISPAVLIVDGKEILGKADIR
NERATIGYGGTEKVLVGPAVHSCMVLCRKAKPGCTID
The query sequence (length=357) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bjr:A | 363 | 363 | 1.0000 | 0.9835 | 0.9835 | 0.0 | 2bjr:B |
2 | 4v6w:CS | 173 | 78 | 0.0672 | 0.1387 | 0.3077 | 1.4 | 6xu6:CS, 6xu7:CS, 6xu8:CS |
3 | 4imp:A | 520 | 90 | 0.0812 | 0.0558 | 0.3222 | 2.2 | 4imp:B, 4imp:C, 4imp:D |
4 | 7uch:A | 636 | 71 | 0.0672 | 0.0377 | 0.3380 | 3.6 | 6b39:A, 6b3a:A, 6b3b:A |
5 | 6j4g:B | 58 | 49 | 0.0420 | 0.2586 | 0.3061 | 4.2 | |
6 | 6q09:A | 162 | 61 | 0.0448 | 0.0988 | 0.2623 | 6.7 | 6tyj:A |