AKDPMRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRKKMYTLTDSGKQELHDWLI
RHQPIPETVKDEFMLKAYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMASAEPMSFSSPDFGHYLVLTKALERE
KNYVSWLESILAMIDED
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5x11:E | 181 | 181 | 0.9718 | 0.9503 | 0.9503 | 6.01e-123 | 5x11:A, 5x11:B, 5x11:D, 5x11:C, 5x11:F, 5x11:H, 5x14:A |
2 | 5z7b:B | 197 | 37 | 0.1017 | 0.0914 | 0.4865 | 6.08e-05 | 6lg2:A, 6lg2:B, 5z7b:A |
3 | 5ven:A | 382 | 66 | 0.1017 | 0.0471 | 0.2727 | 2.4 | 5ven:B, 5veo:A |
4 | 8ffz:B | 905 | 105 | 0.1638 | 0.0320 | 0.2762 | 3.9 | |
5 | 1iom:A | 374 | 40 | 0.0791 | 0.0374 | 0.3500 | 5.3 | 1ixe:A, 1ixe:B, 1ixe:C, 1ixe:D |
6 | 8dau:G | 475 | 47 | 0.0847 | 0.0316 | 0.3191 | 6.3 | 8dar:G, 8das:G, 8dat:G, 8dav:G, 8daw:G, 6jwh:A, 6jwi:A, 6jwi:E, 6jwj:A, 6oa9:G |
7 | 4lt6:A | 467 | 55 | 0.0960 | 0.0364 | 0.3091 | 6.3 | 4lt6:B |
8 | 2fkz:A | 155 | 33 | 0.0678 | 0.0774 | 0.3636 | 6.5 | 2fkz:B, 2fkz:D, 2fkz:C, 2fkz:E, 2fkz:F, 2fkz:G, 2fkz:H, 2fl0:A, 2fl0:F, 2fl0:B, 2fl0:D, 2fl0:C, 2fl0:E, 2fl0:G, 2fl0:H, 1sof:A, 1sof:B, 1sof:C, 1sof:D, 1sof:E, 1sof:F, 1sof:G, 1sof:H |
9 | 3eh8:A | 254 | 60 | 0.1299 | 0.0906 | 0.3833 | 8.3 | 3eh8:D, 3eh8:G, 1p8k:Z, 2qoj:Z |
10 | 6y7f:B | 256 | 31 | 0.0621 | 0.0430 | 0.3548 | 9.6 | 6y7f:A |