AKATRHIFLIRASQYHVRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAP
IEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSIT
HLVIRPNGRVALRTLGDTGFMPPDKITRS
The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6cnl:L | 192 | 192 | 0.9947 | 0.9792 | 0.9792 | 8.51e-139 | 6cnl:A, 6cnl:B, 6cnl:C, 6cnl:D, 6cnl:K, 6cnl:J, 6cnl:I, 6cnl:F, 6cnl:G, 6cnl:E, 6cnl:H |
2 | 3eoz:B | 175 | 186 | 0.3915 | 0.4229 | 0.3978 | 2.30e-36 | |
3 | 4bxr:A | 183 | 56 | 0.1005 | 0.1038 | 0.3393 | 2.3 | 4bxr:B, 4ld3:A, 4lzf:A |
4 | 7xb8:B | 249 | 46 | 0.0847 | 0.0643 | 0.3478 | 3.5 | 6isn:C, 8it4:A, 8it4:B, 8it5:C, 8it6:C, 8it7:C, 8it8:C, 8itb:C, 8itc:C, 8itd:C, 7xb7:B, 7xb7:C, 7xb8:C, 7xb9:B, 7xb9:C, 5y2i:B, 5y2u:B, 5y2u:C, 5y35:C, 5y64:C, 5y65:C, 1yfk:A, 1yjx:B, 1yjx:C, 1yjx:D, 1yjx:E, 1yjx:G, 1yjx:I, 1yjx:J, 1yjx:K, 1yjx:L, 5zrm:C, 5zs8:C |
5 | 7acm:B | 178 | 70 | 0.1005 | 0.1067 | 0.2714 | 4.5 | 7acm:A |
6 | 1zy5:A | 271 | 58 | 0.0794 | 0.0554 | 0.2586 | 6.4 | 1zy5:B, 1zyd:A, 1zyd:B |
7 | 5ue8:A | 847 | 46 | 0.0635 | 0.0142 | 0.2609 | 8.2 | 5ue8:B, 1y8f:A |