AISFRPTADLVDDIGPDVRSCDLQFRQFGGRSQFAGPISTVRCFQDNALLKSVLSQPSAGGVLVIDGAGSLHTALVGDVI
AELARSTGWTGLIVHGAVRDAAALRGIDIGIKALGTNPRKSTKTGAGERDVEITLGGVTFVPGDIAYSDDDGIIVV
The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1nxj:A | 156 | 156 | 1.0000 | 1.0000 | 1.0000 | 6.25e-109 | 1nxj:B, 1nxj:C |
2 | 2yjv:C | 158 | 149 | 0.4359 | 0.4304 | 0.4564 | 1.35e-38 | |
3 | 3noj:A | 235 | 102 | 0.1859 | 0.1234 | 0.2843 | 3.52e-04 | |
4 | 4d61:h | 436 | 55 | 0.1282 | 0.0459 | 0.3636 | 0.84 | 5a8l:Q, 6d90:jj, 6hcf:j1, 6hcm:j1, 6ip8:zw, 3j5y:A, 3jag:ii, 3jah:ii, 3jai:ii, 5lzt:ii, 5lzu:ii, 5lzv:ii, 7nwh:ii, 7o80:By, 6p5n:Aq, 8scb:ii, 6zme:CH |
5 | 3e1y:A | 380 | 55 | 0.1282 | 0.0526 | 0.3636 | 0.97 | 3e1y:B, 6xa1:j |
6 | 4dm9:A | 223 | 82 | 0.1154 | 0.0807 | 0.2195 | 2.1 | 4dm9:B, 8ede:A, 8ede:B, 3ifw:A, 3kvf:A, 3kw5:A, 8pw1:A, 8pw1:B, 8pw1:C, 8pw1:D, 8pw1:E, 8pw1:F, 8pw1:G, 8pw1:H, 8pw1:I, 8pw1:J, 7zm0:A, 7zm0:B, 7zm0:C, 7zm0:D, 7zm0:H, 7zm0:E, 7zm0:F, 7zm0:G, 7zm0:I, 7zm0:J |
7 | 4nq3:A | 351 | 50 | 0.1090 | 0.0484 | 0.3400 | 4.6 | 4nq3:B |