AIQGIEGVISQLQATAMAAVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKL
VAAYQEVMSMQV
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8wkq:P | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 2.93e-61 | 8wk3:P, 8wkk:P, 8wl2:A5, 8wlh:P, 8wln:P, 8wlq:P, 8wlt:A5, 8wo5:A5, 8woe:A5 |
| 2 | 2j9f:D | 329 | 45 | 0.1739 | 0.0486 | 0.3556 | 3.2 | 1dtw:B, 2j9f:B |
| 3 | 7u4h:A | 576 | 82 | 0.2283 | 0.0365 | 0.2561 | 9.1 | 7u4h:B |
| 4 | 2rfb:A | 338 | 37 | 0.1087 | 0.0296 | 0.2703 | 9.6 | 2rfb:B, 2rfb:C, 2rfc:A, 2rfc:B, 2rfc:C, 2rfc:D |
umich.edu