AILYPFTISGNDRNGNFTINFKGTPNSTNNGCIGYSYNGDWEKIEWEGSCDGNGNLVVEVPMSKIPAGVTSGEIQIWWHS
GDLKMTDYKALEHHHH
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5fu3:B | 99 | 96 | 1.0000 | 0.9697 | 1.0000 | 6.16e-69 | 5fu2:A, 5fu2:B, 5fu3:A, 5fu4:A, 5fu4:B |
| 2 | 7onj:A | 262 | 86 | 0.2083 | 0.0763 | 0.2326 | 0.45 | 7onj:B, 7onj:G, 7onj:C, 7onj:D, 7onj:E, 7onj:F, 7ooa:A, 7ooa:B, 7ooa:G, 7ooa:C, 7ooa:D, 7ooa:E, 7ooa:F |
| 3 | 5mol:B | 322 | 32 | 0.1250 | 0.0373 | 0.3750 | 0.52 | 6eyo:A, 4ezm:C, 4gko:C, 4j4p:A, 5moi:B, 5moi:D, 5mok:D, 5mol:A, 7mxi:B, 5nqw:A, 1o0v:A, 1o0v:B, 7shy:A, 7shy:B, 7shz:B, 7si0:B, 7si0:H |
| 4 | 5cvc:A | 329 | 34 | 0.1562 | 0.0456 | 0.4412 | 0.90 | 5cvc:B, 5cvc:C |
| 5 | 4uy7:A | 327 | 22 | 0.1042 | 0.0306 | 0.4545 | 3.1 | 6fnq:A, 6fnq:B, 6fnr:A, 6fnr:B, 6fns:A, 6fns:B, 6fnt:A, 6fnt:B, 4pin:A, 4pin:B, 4pio:A, 4pio:B, 4pip:A, 4pip:B, 4pip:C, 4pip:D, 4uy5:A, 4uy6:A, 4uy7:B |
| 6 | 7nac:m | 666 | 27 | 0.1042 | 0.0150 | 0.3704 | 4.0 | 8e5t:s, 6em1:m, 6em3:B, 7nad:m, 7ohp:m, 7ohs:m, 7ohw:m, 7ohx:m, 7r6q:m, 7r72:m, 7r7a:m, 8v87:m |
| 7 | 6elz:m | 645 | 27 | 0.1042 | 0.0155 | 0.3704 | 4.3 | 6em5:m, 7ohr:m, 7ohv:m |
| 8 | 3u4e:L | 214 | 70 | 0.2083 | 0.0935 | 0.2857 | 5.2 | 8fk5:L |
| 9 | 6cb1:s | 512 | 25 | 0.1042 | 0.0195 | 0.4000 | 5.4 | 6c0f:s |
| 10 | 8hfd:A | 452 | 48 | 0.1250 | 0.0265 | 0.2500 | 6.1 | 3e74:B, 8hfd:B, 8hfd:C, 8hfd:D |
umich.edu