AILYPFTISGNDRNGNFTINFKGTPNSTNNGCIGYSYNGDWEKIEWEGSCDGNGNLVVEVPMSKIPAGVTSGEIQIWAHS
GDLKMTDYKALE
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fu3:B | 99 | 92 | 0.9891 | 0.9192 | 0.9891 | 3.90e-64 | 5fu2:A, 5fu2:B, 5fu3:A, 5fu4:A, 5fu4:B |
2 | 7onj:A | 262 | 82 | 0.2174 | 0.0763 | 0.2439 | 0.20 | 7onj:B, 7onj:G, 7onj:C, 7onj:D, 7onj:E, 7onj:F, 7ooa:A, 7ooa:B, 7ooa:G, 7ooa:C, 7ooa:D, 7ooa:E, 7ooa:F |
3 | 5mol:B | 322 | 42 | 0.1522 | 0.0435 | 0.3333 | 1.2 | 6eyo:A, 4ezm:C, 4gko:C, 4j4p:A, 5moi:B, 5moi:D, 5mok:D, 5mol:A, 7mxi:B, 5nqw:A, 1o0v:A, 1o0v:B, 7shy:A, 7shy:B, 7shz:B, 7si0:B, 7si0:H |
4 | 3u4e:L | 214 | 70 | 0.2174 | 0.0935 | 0.2857 | 3.3 | 8fk5:L |
5 | 5dou:D | 1430 | 66 | 0.2065 | 0.0133 | 0.2879 | 3.4 | 5dou:A, 5dou:B, 5dou:C, 6w2j:A |
6 | 6fv5:B | 382 | 27 | 0.1196 | 0.0288 | 0.4074 | 4.2 | 7b2i:A, 6fv5:A, 7ov9:A, 7ovo:A, 7ovs:A, 7owz:A |