AILDLKSLVLNAINYWGPKNNNGIQGGDFGYPISEKQIDTSIITSTHPRLIPHDLTIPQNLETIFTTTQVLTNNTDLQQS
QTVSFAKKTTTTTSTSTTNGWTEGGKISDTLEEKVSVSIPFIGEGGGKNSTTIEANFAHNSSTTTFQQASTDIEWNISQP
VLVPPRKQVVATLVIMGGNFTIPMDLMTTIDSTEHYSGYPILTWISSPDNSYNGPFMSWYFANWPNLPSGFGPLNSDNTV
TYTGSVVSQVSAGVYATVRFDQYDIHNLRTIEKTWYARHATLHNGKKISINNVTEMAPTSPIKTN
The query sequence (length=305) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pkm:A | 305 | 305 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 4rhz:A | 259 | 133 | 0.1148 | 0.1351 | 0.2632 | 0.003 | |
3 | 4zno:A | 318 | 113 | 0.1115 | 0.1069 | 0.3009 | 0.032 | 4zno:B, 4znq:A, 4znq:B, 4znr:A, 4znr:B |
4 | 4z1d:A | 256 | 157 | 0.1180 | 0.1406 | 0.2293 | 0.67 | 4z1d:B |
5 | 1szn:A | 417 | 77 | 0.0656 | 0.0480 | 0.2597 | 2.1 | 1t0o:A |
6 | 1cur:A | 155 | 34 | 0.0393 | 0.0774 | 0.3529 | 3.1 | 1a3z:A, 1a8z:A, 2cak:A, 2cal:A, 1e30:A, 1e30:B, 1gy1:A, 1gy1:B, 1gy2:A, 1gy2:B, 1rcy:A |
7 | 8a22:Xe | 483 | 102 | 0.0754 | 0.0476 | 0.2255 | 4.5 | 8apn:Xe, 8apo:Xe |