BioLiP

>protein
AIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTDEYLSKLVPDGIKFKHDKFINSHFNVLRGIHGDVKTYKLVTCVYG
EVHQVVVDCRKDSPTYLKWEKFIISYKNQQLILLPPNMGNSHYVSSKEAVYYYKLAYEGEYMDAPDQFTYAWNDERIGID
WPTNTPILSDRDILATK

The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7m15:D	181	177	0.9887	0.9669	0.9887	1.87e-131	7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F
2	8dco:B	181	175	0.8983	0.8785	0.9086	8.47e-121	8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A
3	8dcl:A	185	177	0.8023	0.7676	0.8023	3.33e-108	7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B
4	1dzt:A	183	165	0.3164	0.3060	0.3394	2.61e-25	1dzt:B
5	6ndr:A	188	162	0.2938	0.2766	0.3210	5.79e-19	6ndr:B
6	3ryk:A	175	174	0.2768	0.2800	0.2816	8.46e-19	3ryk:B
7	6c46:A	183	166	0.2938	0.2842	0.3133	2.15e-18	6c46:D
8	2ixh:A	184	161	0.2655	0.2554	0.2919	2.44e-18	2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B
9	7pvi:AAA	199	176	0.2825	0.2513	0.2841	2.07e-15	7pvi:BBB, 7pwb:AAA, 7pwb:BBB
10	1epz:A	183	168	0.2938	0.2842	0.3095	4.80e-15
11	2ixc:A	198	170	0.2599	0.2323	0.2706	7.46e-14	2ixc:B, 2ixc:C, 2ixc:D
12	5buv:A	174	167	0.2825	0.2874	0.2994	5.26e-12	5buv:B
13	1oi6:A	202	177	0.2768	0.2426	0.2768	2.60e-11	1oi6:B
14	7pwh:AAA	203	165	0.2712	0.2365	0.2909	8.47e-10
15	4hn1:C	201	165	0.2542	0.2239	0.2727	5.12e-07	4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D
16	8bf8:A	302	61	0.0960	0.0563	0.2787	1.1
17	7cp7:A	430	87	0.1243	0.0512	0.2529	1.4	7cp6:A, 7cp6:B
18	8auv:C	117	62	0.1073	0.1624	0.3065	2.2	8b2l:C1
19	8h1j:A	362	61	0.0960	0.0470	0.2787	2.4	8ex9:A, 8exa:A
20	7s6e:B	400	93	0.1299	0.0575	0.2473	9.9	7s6e:A

[Back]