AHYLQRFGEAALPPLVPFSEALKIREEAYKLGQVWPFEHVVPGVPKAPNATAYLERKKQKEEKRTKRAKEINDALAKMPQ
LIADYKAARKIDWAEVSIIDKLTLSKKQIREKYVKRRLMKQN
The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a22:AJ | 122 | 122 | 1.0000 | 1.0000 | 1.0000 | 4.37e-86 | 8apn:AJ, 8apo:AJ |
2 | 7pkt:J | 114 | 95 | 0.4098 | 0.4386 | 0.5263 | 5.51e-27 | |
3 | 7l08:q | 168 | 34 | 0.0984 | 0.0714 | 0.3529 | 0.024 | 7a5f:q3, 7a5g:q3, 7a5i:q3, 7a5j:q, 7a5k:q3, 8any:q, 6i9r:q, 8k2a:L8, 8k2b:L8, 7l20:q, 6nu2:q, 6nu3:q, 7o9k:q, 7o9m:q, 7odr:q, 7ods:q, 7odt:q, 7of0:q, 7of2:q, 7of3:q, 7of4:q, 7of5:q, 7of6:q, 7of7:q, 7og4:q, 7oi8:q, 7oia:q, 7oic:q, 7oid:q, 8oir:Bg, 8oit:Bg, 8pk0:q, 7po4:q, 7qh6:q, 7qh7:q, 7qi4:q, 7qi5:q, 7qi6:q, 8qsj:q, 6vlz:q, 6vmi:q, 8xt0:L8, 8xt1:L8, 8xt2:L8, 8xt3:L8, 6zm5:q, 6zm6:q, 6zs9:q, 6zsa:q, 6zsb:q, 6zsc:q, 6zsd:q, 6zse:q, 6zsg:q |
4 | 6gaw:Bv | 135 | 27 | 0.0902 | 0.0815 | 0.4074 | 0.86 | 5aj4:Bv, 6gb2:Bv, 7nqh:Bv, 7nql:Bv, 7nsh:Bv, 7nsi:Bv, 7nsj:Bv, 8oin:Bg, 8oiq:Bg, 6ydp:Bv, 6ydw:Bv |
5 | 6xyw:AK | 87 | 68 | 0.1639 | 0.2299 | 0.2941 | 0.89 | |
6 | 1smr:A | 331 | 60 | 0.1721 | 0.0634 | 0.3500 | 3.0 | 1smr:C, 1smr:E, 1smr:G |
7 | 7v8i:D | 229 | 58 | 0.1393 | 0.0742 | 0.2931 | 3.0 | 7arj:F, 7arj:D, 7ark:D, 7ark:F, 7arl:F, 7arl:D, 7mdy:D, 7mdy:C, 7v8i:F |
8 | 6ype:A | 205 | 76 | 0.1803 | 0.1073 | 0.2895 | 4.3 | 6ype:B |
9 | 3sp1:B | 439 | 30 | 0.1148 | 0.0319 | 0.4667 | 5.3 | 3sp1:A |
10 | 8tua:A | 1329 | 22 | 0.0820 | 0.0075 | 0.4545 | 7.1 | 5d3x:A, 5d3x:B, 5d3y:A, 5d3y:B, 5fi0:A, 5fi0:C, 5fi0:E, 5fi0:G |
11 | 3ztv:A | 565 | 35 | 0.0984 | 0.0212 | 0.3429 | 9.0 | 3zu0:A |