AHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAG
LSERDINLASFIEQVAVSM
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1f93:A | 103 | 99 | 1.0000 | 0.9612 | 1.0000 | 1.08e-71 | 1dcp:A, 1dcp:B, 1dcp:C, 1dcp:D, 1dcp:E, 1dcp:F, 1dcp:G, 1dcp:H, 1f93:B, 1f93:C, 1f93:D |
2 | 2v6t:B | 100 | 94 | 0.4545 | 0.4500 | 0.4787 | 1.70e-27 | 2v6t:A |
3 | 2bib:A | 540 | 63 | 0.2020 | 0.0370 | 0.3175 | 0.42 | 1wra:A, 1wra:B |
4 | 4qi7:A | 805 | 26 | 0.1010 | 0.0124 | 0.3846 | 0.69 | 4qi7:B |
5 | 5bxa:A | 414 | 49 | 0.1515 | 0.0362 | 0.3061 | 1.5 | |
6 | 8wt1:C | 651 | 67 | 0.2020 | 0.0307 | 0.2985 | 1.7 | 8wt1:A, 8wt1:B, 8wt1:D, 8wt1:E, 8wt1:F, 8wt1:G, 8wt1:H |
7 | 5u8t:2 | 583 | 81 | 0.2121 | 0.0360 | 0.2593 | 2.1 | |
8 | 7pt6:2 | 629 | 81 | 0.2121 | 0.0334 | 0.2593 | 2.2 | 5bk4:2, 5bk4:A, 6eyc:2, 6f0l:A, 6f0l:2, 3ja8:2, 7p30:2, 7p30:A, 7p5z:2, 7p5z:A, 7pt6:B, 7pt7:2, 7pt7:B, 6rqc:2, 6sko:2, 5u8s:2, 7v3u:2, 7v3u:B, 7v3v:2, 7v3v:B, 5v8f:2, 8w7m:2, 7w8g:2, 7w8g:B |
9 | 8b9a:2 | 568 | 81 | 0.2121 | 0.0370 | 0.2593 | 2.7 | 8b9b:2, 8b9c:2 |
10 | 8xgc:2 | 778 | 81 | 0.2121 | 0.0270 | 0.2593 | 3.1 | 8kg6:2, 8kg8:2, 8kg9:2, 8p5e:2, 8p62:2, 8p63:2, 7pmk:2, 7pmn:2, 6ptn:i, 6ptn:2, 6pto:h, 6pto:2, 7qhs:2, 6skl:2, 6u0m:2, 7z13:2, 7z13:a |
11 | 6ori:A | 381 | 83 | 0.2323 | 0.0604 | 0.2771 | 5.5 | |
12 | 6lt4:A | 623 | 58 | 0.1616 | 0.0257 | 0.2759 | 8.9 | 6lt4:B, 6lt4:C, 6lt4:D, 6lt4:E, 6lt4:F, 6lt4:G, 6lt4:H, 6lt4:I, 6lt4:J, 6lt4:K, 6lt4:L, 6lt4:M, 6lt4:N |